KEGG   Streptomyces coelicolor: SCO1844Help
Entry
SCO1844           CDS       T00085                                 

Gene name
SCI8.29c
Definition
aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
sco  Streptomyces coelicolor
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SCO1844 (SCI8.29c)
Enzymes [BR:sco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     SCO1844 (SCI8.29c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(1972995..1973717)
Genome map
AA seq 240 aa AA seqDB search
MTYSRAGGAEGAGEPDREAAGDPTAEPAREAAWAELVATARRTVADGLVVGTSGNVSVRV
GDTVLVTPSGVPYDRLTPDDATGVDLDGRQVLGTLVPTSELPMHLAVYRADPGARAVVHT
HAVHATAVSLLVPELPPVHYMTAALGGPVRVAPYAAYGTAELARGMLDALAGRTGCLLRN
HGTITYGTSLDQAYDRTAQLEWMCRLWLTASSVPGHSPSLLTPAQLAEVTERLRGYGQRS
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtattcgcgggccggaggggcggaaggggccggggagccggaccgggaagcggcc
ggggatccgaccgcggagccggcccgggaagcggcctgggcggaactcgtcgcgacggcc
cggcggacggtcgccgacggactggtggtgggcacctccggcaacgtctcggtgcgcgtc
ggcgacacggtcctggtcaccccgtcgggcgtcccctacgaccggctgaccccggacgac
gcgaccggcgtcgacctggacggacggcaggtgctcggcaccctcgtccccaccagcgaa
ctgcccatgcacctcgccgtgtaccgcgccgaccccggtgcccgggccgtcgtccacacc
cacgccgtgcacgcgacggcggtctcgctgctcgtccccgaactcccgccggtgcactac
atgaccgccgccctcggcggccccgtccgggtcgccccctacgcggcctacggcaccgcc
gaactcgcccgcggcatgctcgacgccctcgccggccgcaccggctgcctgctccgcaac
cacggcacgatcacctacggcacctccctcgaccaggcctacgaccgcaccgcccagctc
gagtggatgtgccgcctgtggctgaccgcgtcctcggtgcccggccactcgccgtccctg
ctgacgccggcccagctcgccgaggtgaccgaacgcctccgggggtacgggcagcgaagc
tga

DBGET integrated database retrieval system