KEGG   Streptomyces coelicolor: SCO1879Help
Entry
SCO1879           CDS       T00085                                 

Gene name
SCI39.26c
Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
sco  Streptomyces coelicolor
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SCO1879 (SCI39.26c)
   00500 Starch and sucrose metabolism
    SCO1879 (SCI39.26c)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     SCO1879 (SCI39.26c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(2011647..2012792)
Genome map
AA seq 381 aa AA seqDB search
MHPPAPSRRGFLLATAGAGAALGLAAAGPAVAGARPHPRPFGRYGSPAARRTPRTLYVDP
HGRGDFTSVQSAVDAAAGDGWALVLAPGTYRETVSVDAQRTGATWIGASGDPRDVVIVYD
NAAGTPKPDGSGTHGTSGSATTTVRADGFTARAVTFANDWLRADRPDWTGTQAVAIKVMG
DRSAFHDCRFLGHQDTLYADSRDLALFARQYYERCYVEGDVDFVFGRATAVYEQCHFRTL
VRTDLDAAPYGFVFAPSTAGANPRGYLVIRGRVSSEAPDGYYKLARPWVPSSDTTARPML
TVRETRLGAGVDAVAPYANMRDAYPWQEQRFREYRNTGPGAAVTVPDNRPQLTRAEAAAH
TREAYLGDWRPYDRQHHHGRY
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcacccacccgccccgtcccgcagaggcttcctcctggcgaccgccggcgcgggcgcc
gccctcggcctcgcggcagccggtcccgccgtcgccggcgcccggccgcacccgcgtccc
ttcggccggtacggctcaccggccgcccgccgtacacccaggaccctgtacgtcgacccg
cacggccgcggcgacttcacctccgtccagagcgcggtcgacgccgccgccggcgacggc
tgggcactcgtcctggctccgggcacctaccgcgagacggtctccgtcgacgcccagcgc
accggggcgacctggatcggagcctccggcgacccgcgcgacgtcgtcatcgtctacgac
aacgcggccggcacccccaagccggacggctccggcacccacggcaccagcggttcggcc
accaccaccgtgcgcgccgacggcttcaccgcccgcgccgtcaccttcgccaacgactgg
ctgcgcgccgaccggcccgactggaccggcacccaggcggtcgcgatcaaggtcatgggc
gaccgctccgccttccacgactgccgtttcctcggccaccaggacaccctctacgccgac
agccgcgacctcgccctcttcgcccgccagtactacgagcgctgctacgtcgagggcgac
gtcgacttcgtcttcggccgggcgacggcggtgtacgagcagtgccacttccgcaccctg
gtccgcaccgacctcgacgccgccccgtacggcttcgtcttcgcgccctccacggcgggc
gccaacccgcgcggctacctggtgatccgcggccgcgtcagcagcgaggcccccgacggc
tactacaagctggcccgcccctgggtgcccagctccgacaccaccgcccgtccgatgctc
accgtgcgcgagacccgcctcggtgcgggcgtcgacgcggtggcgccgtacgccaacatg
cgcgacgcgtacccctggcaggagcagcggttccgcgagtaccgcaacaccggccccggc
gccgcggtcaccgtcccggacaaccggccgcagctcacccgcgccgaggccgccgcgcac
acccgcgaggcgtacctcggcgactggcggccctacgaccggcagcaccaccacggccgg
tactga

DBGET integrated database retrieval system