KEGG   Streptomyces coelicolor: SCO1945Help
Entry
SCO1945           CDS       T00085                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sco  Streptomyces coelicolor
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO1945 (tpiA)
   01230 Biosynthesis of amino acids
    SCO1945 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO1945 (tpiA)
   00051 Fructose and mannose metabolism
    SCO1945 (tpiA)
   00562 Inositol phosphate metabolism
    SCO1945 (tpiA)
Enzymes [BR:sco01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SCO1945 (tpiA)
Exosome [BR:sco04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SCO1945 (tpiA)
  Exosomal proteins of bladder cancer cells
   SCO1945 (tpiA)
  Exosomal proteins of melanoma cells
   SCO1945 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(2078015..2078791)
Genome map
AA seq 258 aa AA seqDB search
MTTRTPLMAGNWKMNLNHLEAIAHVQKLAFALADKDYDAVEVAVLAPFTDLRSVQTLVDG
DKLKIKYGAQDISAHDGGAYTGEISGPMLAKLKCTYVAVGHSERRQYHAETDEIVNAKVK
AAYKHGLTPILCVGEELDVREAGNHVEHTLAQVEGGLKDLAAEQAESVVIAYEPVWAIGT
GKVCGADDAQEVCAAIRGKLAELYSQELADKVRIQYGGSVKSGNVAEIMAKPDIDGALVG
GASLDSDEFVKIVRFRDQ
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaccacccgcacgccgctgatggcgggcaactggaagatgaacctcaaccacctggag
gccatcgcccacgtccagaagctcgccttcgccctcgcggacaaggactacgacgccgtc
gaggtcgccgtcctcgcccccttcaccgacctgcgctccgtgcagaccctggtcgacggg
gacaagctcaagatcaagtacggtgcccaggacatctccgcgcacgacggcggcgcctac
accggcgagatctcgggcccgatgctggccaagctgaagtgcacgtacgtggccgtcggc
cactccgagcgccggcagtaccacgccgagaccgacgagatcgtgaacgccaaggtcaag
gccgcctacaagcacggcctgaccccgatcctgtgcgtcggcgaggaactggacgtccgc
gaggcgggcaaccacgtcgagcacaccctcgcccaggtcgagggcggtctgaaggacctt
gcggccgagcaggccgagtccgtcgtgatcgcctacgagcccgtgtgggccatcggcacc
ggcaaggtctgcggcgccgacgacgcccaggaggtctgcgcggcgatccgcggcaagctc
gccgagctgtactcccaggagctggccgacaaggtccgcatccagtacggcggctccgtc
aagtccggcaacgtcgccgagatcatggccaagcccgacatcgacggcgccctggtcggc
ggcgcctcgctggactcggacgagttcgtcaagatcgtccgcttccgcgaccagtag

DBGET integrated database retrieval system