KEGG   Streptomyces coelicolor: SCO2037Help
Entry
SCO2037           CDS       T00085                                 

Gene name
SC4G6.06c, trpB
Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sco  Streptomyces coelicolor
Pathway
sco00260  Glycine, serine and threonine metabolism
sco00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
sco01230  Biosynthesis of amino acids
Module
sco_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO2037 (SC4G6.06c)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCO2037 (SC4G6.06c)
Enzymes [BR:sco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SCO2037 (SC4G6.06c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 1097471
NCBI-ProteinID: NP_626297
Kitasato: SCO2037
UniProt: O05625
Position
complement(2188023..2189306)
Genome map
AA seq 427 aa AA seqDB search
MPSNFFIPDPEGQVPSAEGYFGAFGGKFIPEALVAAVDEVAVEYDKAKSDPEFARELDDL
LVHYTGRPSALTEVPRFAAEAGGARIFLKREDLNHTGSHKINNVLGQALLTKRMGKTRVI
AETGAGQHGVATATACALFGLDCTIYMGEIDTRRQALNVARMRMLGAEVIAVKSGSRTLK
DAINEAFRDWVANVDRTHYLFGTVAGPHPFPAMVRDFHRVIGVEARRQLLEQAGRLPDAA
IACVGGGSNAIGLFHAFIPDADVRLIGCEPAGHGVETGEHAATLTAGEPGILHGSRSYVL
QDDEGQITEPYSISAGLDYPGIGPEHAYLKDSGRGEYRAVTDDAAMQALRLLSRTEGIIP
AIESAHALAGALEVGRELGRDGLLVVNLSGRGDKDMDTAARYFGLYDTDAEVAADGTGAA
EIEGDAK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgcccagtaacttcttcatccccgatccggagggtcaagtcccctccgccgagggctac
ttcggcgccttcgggggcaagttcatccccgaggccctcgtcgcggcggtcgacgaggtc
gccgtcgagtacgacaaggccaagtccgacccggagttcgcccgcgagctggacgacctg
ctcgtccactacacgggccgcccctcggccctcaccgaggtcccccgtttcgccgccgag
gccggcggggcccggatcttcctcaagcgcgaggacctgaaccacaccggctcacacaag
atcaacaacgtgctcggccaggccctgctcaccaagcgcatgggcaagacccgcgtcatc
gccgagaccggcgcgggccagcacggtgtggccacggcgaccgcctgcgccctcttcggc
ctcgactgcaccatctacatgggcgagatcgacacccgccgccaggcactcaacgtggcc
cgcatgcgcatgctcggcgccgaggtcatcgcggtgaagtccggcagccgcaccctgaag
gacgcgatcaacgaggccttccgcgactgggtcgccaacgtcgaccgcacccactacctg
ttcggcaccgtcgcggggccgcaccccttcccggcgatggtccgcgacttccaccgcgtc
atcggcgtggaggccaggcgccagctcctggagcaggccgggcgcctgcccgacgccgcg
atcgcctgcgtcggcggcggctccaacgccatcggcctcttccacgccttcatccccgac
gcggacgtccgcctcatcggctgcgagcccgccgggcacggtgtggagaccggcgagcac
gcggccaccctgaccgcgggcgagcccggcatcctgcacggctcccggtcctacgtcctc
caggacgacgagggccagatcaccgagccgtactcgatctcggccggtctggactacccc
ggcatcggcccggagcacgcctacctcaaggactccggccgcggcgagtaccgcgcggtc
accgacgacgccgccatgcaggccctgcgcctgctgtcgcgcaccgagggcatcatcccg
gccatcgagagcgcccacgcgctggccggcgccctggaggtcggcagggagctgggcagg
gacgggctactcgtcgtcaacctgtccggccgcggcgacaaggacatggacaccgccgcc
cgctacttcgggctgtacgacaccgacgccgaggtcgccgccgacgggaccggcgccgcg
gagatcgagggggacgccaagtga

DBGET integrated database retrieval system