KEGG   Streptomyces coelicolor: SCO2037Help
Entry
SCO2037           CDS       T00085                                 

Gene name
SC4G6.06c, trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sco  Streptomyces coelicolor
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCO2037 (SC4G6.06c)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO2037 (SC4G6.06c)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCO2037 (SC4G6.06c)
Enzymes [BR:sco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SCO2037 (SC4G6.06c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(2188023..2189306)
Genome map
AA seq 427 aa AA seqDB search
MPSNFFIPDPEGQVPSAEGYFGAFGGKFIPEALVAAVDEVAVEYDKAKSDPEFARELDDL
LVHYTGRPSALTEVPRFAAEAGGARIFLKREDLNHTGSHKINNVLGQALLTKRMGKTRVI
AETGAGQHGVATATACALFGLDCTIYMGEIDTRRQALNVARMRMLGAEVIAVKSGSRTLK
DAINEAFRDWVANVDRTHYLFGTVAGPHPFPAMVRDFHRVIGVEARRQLLEQAGRLPDAA
IACVGGGSNAIGLFHAFIPDADVRLIGCEPAGHGVETGEHAATLTAGEPGILHGSRSYVL
QDDEGQITEPYSISAGLDYPGIGPEHAYLKDSGRGEYRAVTDDAAMQALRLLSRTEGIIP
AIESAHALAGALEVGRELGRDGLLVVNLSGRGDKDMDTAARYFGLYDTDAEVAADGTGAA
EIEGDAK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgcccagtaacttcttcatccccgatccggagggtcaagtcccctccgccgagggctac
ttcggcgccttcgggggcaagttcatccccgaggccctcgtcgcggcggtcgacgaggtc
gccgtcgagtacgacaaggccaagtccgacccggagttcgcccgcgagctggacgacctg
ctcgtccactacacgggccgcccctcggccctcaccgaggtcccccgtttcgccgccgag
gccggcggggcccggatcttcctcaagcgcgaggacctgaaccacaccggctcacacaag
atcaacaacgtgctcggccaggccctgctcaccaagcgcatgggcaagacccgcgtcatc
gccgagaccggcgcgggccagcacggtgtggccacggcgaccgcctgcgccctcttcggc
ctcgactgcaccatctacatgggcgagatcgacacccgccgccaggcactcaacgtggcc
cgcatgcgcatgctcggcgccgaggtcatcgcggtgaagtccggcagccgcaccctgaag
gacgcgatcaacgaggccttccgcgactgggtcgccaacgtcgaccgcacccactacctg
ttcggcaccgtcgcggggccgcaccccttcccggcgatggtccgcgacttccaccgcgtc
atcggcgtggaggccaggcgccagctcctggagcaggccgggcgcctgcccgacgccgcg
atcgcctgcgtcggcggcggctccaacgccatcggcctcttccacgccttcatccccgac
gcggacgtccgcctcatcggctgcgagcccgccgggcacggtgtggagaccggcgagcac
gcggccaccctgaccgcgggcgagcccggcatcctgcacggctcccggtcctacgtcctc
caggacgacgagggccagatcaccgagccgtactcgatctcggccggtctggactacccc
ggcatcggcccggagcacgcctacctcaaggactccggccgcggcgagtaccgcgcggtc
accgacgacgccgccatgcaggccctgcgcctgctgtcgcgcaccgagggcatcatcccg
gccatcgagagcgcccacgcgctggccggcgccctggaggtcggcagggagctgggcagg
gacgggctactcgtcgtcaacctgtccggccgcggcgacaaggacatggacaccgccgcc
cgctacttcgggctgtacgacaccgacgccgaggtcgccgccgacgggaccggcgccgcg
gagatcgagggggacgccaagtga

DBGET integrated database retrieval system