KEGG   Streptomyces coelicolor: SCO2037Help
Entry
SCO2037           CDS       T00085                                 

Gene name
SC4G6.06c, trpB
Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sco  Streptomyces coelicolor
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCO2037 (SC4G6.06c)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO2037 (SC4G6.06c)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCO2037 (SC4G6.06c)
Enzymes [BR:sco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SCO2037 (SC4G6.06c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(2188023..2189306)
Genome map
AA seq 427 aa AA seqDB search
MPSNFFIPDPEGQVPSAEGYFGAFGGKFIPEALVAAVDEVAVEYDKAKSDPEFARELDDL
LVHYTGRPSALTEVPRFAAEAGGARIFLKREDLNHTGSHKINNVLGQALLTKRMGKTRVI
AETGAGQHGVATATACALFGLDCTIYMGEIDTRRQALNVARMRMLGAEVIAVKSGSRTLK
DAINEAFRDWVANVDRTHYLFGTVAGPHPFPAMVRDFHRVIGVEARRQLLEQAGRLPDAA
IACVGGGSNAIGLFHAFIPDADVRLIGCEPAGHGVETGEHAATLTAGEPGILHGSRSYVL
QDDEGQITEPYSISAGLDYPGIGPEHAYLKDSGRGEYRAVTDDAAMQALRLLSRTEGIIP
AIESAHALAGALEVGRELGRDGLLVVNLSGRGDKDMDTAARYFGLYDTDAEVAADGTGAA
EIEGDAK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgcccagtaacttcttcatccccgatccggagggtcaagtcccctccgccgagggctac
ttcggcgccttcgggggcaagttcatccccgaggccctcgtcgcggcggtcgacgaggtc
gccgtcgagtacgacaaggccaagtccgacccggagttcgcccgcgagctggacgacctg
ctcgtccactacacgggccgcccctcggccctcaccgaggtcccccgtttcgccgccgag
gccggcggggcccggatcttcctcaagcgcgaggacctgaaccacaccggctcacacaag
atcaacaacgtgctcggccaggccctgctcaccaagcgcatgggcaagacccgcgtcatc
gccgagaccggcgcgggccagcacggtgtggccacggcgaccgcctgcgccctcttcggc
ctcgactgcaccatctacatgggcgagatcgacacccgccgccaggcactcaacgtggcc
cgcatgcgcatgctcggcgccgaggtcatcgcggtgaagtccggcagccgcaccctgaag
gacgcgatcaacgaggccttccgcgactgggtcgccaacgtcgaccgcacccactacctg
ttcggcaccgtcgcggggccgcaccccttcccggcgatggtccgcgacttccaccgcgtc
atcggcgtggaggccaggcgccagctcctggagcaggccgggcgcctgcccgacgccgcg
atcgcctgcgtcggcggcggctccaacgccatcggcctcttccacgccttcatccccgac
gcggacgtccgcctcatcggctgcgagcccgccgggcacggtgtggagaccggcgagcac
gcggccaccctgaccgcgggcgagcccggcatcctgcacggctcccggtcctacgtcctc
caggacgacgagggccagatcaccgagccgtactcgatctcggccggtctggactacccc
ggcatcggcccggagcacgcctacctcaaggactccggccgcggcgagtaccgcgcggtc
accgacgacgccgccatgcaggccctgcgcctgctgtcgcgcaccgagggcatcatcccg
gccatcgagagcgcccacgcgctggccggcgccctggaggtcggcagggagctgggcagg
gacgggctactcgtcgtcaacctgtccggccgcggcgacaaggacatggacaccgccgcc
cgctacttcgggctgtacgacaccgacgccgaggtcgccgccgacgggaccggcgccgcg
gagatcgagggggacgccaagtga

DBGET integrated database retrieval system