KEGG   Streptomyces coelicolor: SCO2123Help
Entry
SCO2123           CDS       T00085                                 

Gene name
SC6E10.17
Definition
esterase/lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
sco  Streptomyces coelicolor
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
2283639..2284442
Genome map
AA seq 267 aa AA seqDB search
MSVLPGAEPFRHEGGDVGVLLCHGFTGSPQSLRPWARYLAARGLTVSLPLLPGHGTRWQD
MQVTGWQDWYAEVDRELRALRERCERVFVAGLSMGGALALRLAAKHGDAVSGVVVVNPAN
RMHGVAQHALPVLRHLVPATKGIASDIAKPLSTELGYDRVPLHSAHSLRAFFRLADGDLP
QVTQPLLLLRSPQDHVVPPADSARILGRVSSTDVTEILLEQSYHVATLDHDADRIFAESV
AFIGRLAPGSVGEPESGLGKEGTAAGG
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtgtcggtcctgcccggagccgagccgttccgccacgagggcggtgacgtcggcgtcctc
ctctgtcacggtttcaccggttccccgcagtcgctgcgcccctgggcccggtaccttgcc
gcgcgcggcctgaccgtgtcgctgccgctgctgcccgggcacggcacgcgctggcaggac
atgcaggtcaccggctggcaggactggtacgcggaggtggaccgcgagctgcgtgccctg
cgcgagcgctgcgagcgcgtcttcgtggccggtctgtccatgggcggcgcgctggcgctg
cggctggccgccaagcacggggacgcggtgtcgggcgtcgtcgtcgtcaacccggcgaac
aggatgcacggcgtcgcccagcacgcccttccggtcctgcgccacctggtgcccgcgacg
aagggcatcgccagcgacatcgccaagccgctcagcacggagctggggtacgaccgggtg
ccgctgcactcggcgcactcgctgcgcgccttcttccggctggccgacggcgacctgccg
caggtgacccagccgctgctgctgctgcgcagtccgcaggaccacgtggtgccgccggcc
gactcggcgcggatcctgggccgggtgtcgtcgacggacgtgacggagatcctgctggaa
cagagctaccacgtggcgacgttggaccacgatgcggaccggatcttcgctgagagcgtc
gcgttcatcggccggctcgcgcccggttccgtcggggaaccggagtccggtctcggcaag
gaagggacggccgcaggtggctga

DBGET integrated database retrieval system