KEGG   Streptomyces coelicolor: SCO2181Help
Entry
SCO2181           CDS       T00085                                 

Gene name
SC5F7.20, sucB
Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sco  Streptomyces coelicolor
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO2181 (SC5F7.20)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCO2181 (SC5F7.20)
  Amino acid metabolism
   00310 Lysine degradation
    SCO2181 (SC5F7.20)
Enzymes [BR:sco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SCO2181 (SC5F7.20)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
2345796..2347568
Genome map
AA seq 590 aa AA seqDB search
MAVSVTLPALGESVTEGTVTRWLKAEGERVEADEPLLEVSTDKVDTEIPAPASGVLSSIK
VAEDETVEVGAELALIDDGSGAPAAAPAPQAEQVAEPAPEPAPAAPSTEQAAPAPAPTAD
AAAGGSAQGTDVVLPALGESVTEGTVTRWLKSVGDSVEEDEPLLEVSTDKVDTEIPAPAS
GTLLEIVVGEDETAEVGAKLAVIGAAGAAPAAAPAAPAAPAQEAPAAPAQPEPTPAPAPA
QAAPAPAPQAPAAPAPQPAAPAPAPAPAAAPAAPAAAQPVDDGAYVTPLVRKLAAENGVD
LSTVKGTGVGGRIRKQDVAAAAEAAKAAAPAPAAAPAAPAAKKAPVLEASPLRGQTVKMP
RIRKVIGDNMVKALHEQAQLSSVVEVDVTRLMKLRARAKDAFAAREGVKLSPMPFFVKAA
AQALKAHAPVNAKINEAEGTITYFDTENIGIAVDSEKGLMTPVIKNAGDLNLAGIAKATA
DLAGKVRASKISPDELAGATFTISNTGSRGALFDTIIVPPGQVAILGIGATVKRPAVIET
EDGPVIGVRDMTYLTLSYDHRLVDGADAARYLTAVKAILEAGEFEVELGL
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggcggtttccgtaacccttccggcgctcggcgagagcgtcaccgagggcaccgtcacc
cgctggctgaaggccgagggtgagcgcgtcgaggccgacgagccgttgctcgaggtctcg
accgacaaggtcgacaccgagatcccggcccccgcctcgggcgtgctgtcctccatcaag
gtcgccgaggacgagaccgtcgaggtcggcgccgagctggcgctgatcgacgacggcagc
ggcgcccccgccgccgccccggccccgcaggccgagcaggtcgccgagccggcccccgag
cccgccccggccgccccttccaccgagcaggccgccccggcgcccgctcccaccgccgac
gccgccgccggcggctccgcgcagggcacggacgtggtcctgcccgcgctcggcgagtcc
gtcaccgagggcaccgtcacccgctggctgaagtcggtcggtgacagcgtcgaggaggac
gagccgctgctcgaggtctcgaccgacaaggtcgacaccgagatcccggcccccgcctcc
ggcaccctgctggagatcgtggtcggcgaggacgagacggccgaggtcggcgccaagctc
gccgtcatcggtgcggcgggtgccgccccggcggctgccccggccgcccccgcggccccg
gcccaggaggccccggccgccccggcccagcccgagcccaccccggccccggctcccgcg
caggccgctccggctccggccccgcaggcgccggcggctccggccccgcagcccgccgct
ccggcgcccgcaccggccccggccgccgctccggctgccccggccgccgcccagccggtg
gacgacggcgcctacgtcaccccgctggtgcgcaagctcgccgccgagaacggcgtcgac
ctgtccaccgtcaagggcaccggcgtcggcggccgcatccgcaagcaggacgtcgccgcc
gccgccgaggccgcgaaggccgccgccccggctccggccgccgcccccgccgcgcccgcc
gcgaagaaggcccccgtcctggaggcctccccgctgcgtggccagaccgtcaagatgccg
cgcatccgcaaggtcatcggcgacaacatggtcaaggcgctgcacgagcaggcccagctg
tcgtcggtcgtcgaggtcgacgtcacccgtctgatgaagctgcgcgcccgtgccaaggac
gcgttcgcggcgcgcgagggcgtcaagctctccccgatgccgttcttcgtcaaggccgcg
gcccaggccctcaaggcccacgccccggtcaacgccaagatcaacgaggccgaggggacc
atcacctacttcgacaccgagaacatcggtatcgcggtggactccgagaagggcctgatg
accccggtcatcaagaacgccggtgacctgaacctggccggcatcgccaaggcgaccgcc
gacctggcgggcaaggtgcgggccagcaagatcagcccggacgagctggccggtgcgacc
ttcaccatcagcaacaccggttcgcgcggcgcgctgttcgacacgatcatcgtgccgccg
ggccaggtcgccatcctcggcatcggtgccacggtcaagcgtccggccgtcatcgagacg
gaggacggcccggtcatcggcgtccgcgacatgacgtacctgaccctgtcctacgaccac
cgtctggtggacggcgccgacgccgcccgctacctgacggcggtcaaggcgatcctggag
gcgggcgagttcgaggtcgagctcggcctgtag

DBGET integrated database retrieval system