KEGG   Streptomyces coelicolor: SCO2292Help
Entry
SCO2292           CDS       T00085                                 

Gene name
xlnB
Definition
endo-1,4-beta-xylanase B
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
sco  Streptomyces coelicolor
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(2461505..2462512)
Genome map
AA seq 335 aa AA seqDB search
MNLLVQPRRRRRGPVTLLVRSAWAVALAALAALMLPGTAQADTVVTTNQEGTNNGYYYSF
WTDSQGTVSMNMGSGGQYSTSWRNTGNFVAGKGWANGGRRTVQYSGSFNPSGNAYLALYG
WTSNPLVEYYIVDNWGTYRPTGEYKGTVTSDGGTYDIYKTTRVNKPSVEGTRTFDQYWSV
RQAKRTGGTITTGNHFDAWARAGMPLGNFSYYMIMATEGYQSSGSSSINVGGTGGGDNGG
GDNGGGGGGCTATVSAGQKWGDRYNLDVSVSGASDWTVTMNVPSPAKVLSTWNVNASYPS
AQTLTARSNGSGNNWGATIQANGNWTWPSVSCSAG
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgctcgtccagccgaggcgtcgcagacgcggtccggtcaccttgctcgtcagg
agcgcgtgggccgtcgcgctggcggcgctcgccgcgctgatgctgccgggcaccgcccag
gccgacacggtcgtcacgaccaaccaggagggcaccaacaacggctactactactcgttc
tggaccgacagccagggcaccgtctccatgaacatgggctccggcggtcagtacagcacc
tcgtggcgcaacaccggcaacttcgtcgcgggcaagggctgggccaacggcggccgccgg
accgtgcagtactcgggcagcttcaacccctccggcaacgcgtacctggcgctctacgga
tggacgtcgaacccgctcgtcgagtactacatcgtcgacaactggggcacctaccggccc
acgggcgagtacaagggcaccgtcaccagcgacggcggcacctacgacatctacaagacg
acccgcgtcaacaagccctccgtcgagggcacccgcaccttcgaccagtactggagcgtc
cggcaggcgaagcggaccggcggcaccatcacgaccggcaaccacttcgacgcgtgggcc
cgggccgggatgccgctcggcaacttcagctactacatgatcatggccaccgagggctac
cagagcagcggcagctccagcatcaacgtcggcgggaccggcggcggcgacaacggcggc
ggcgacaacgggggcggtggcggcgggtgcaccgccacggtgtccgccgggcagaagtgg
ggcgaccggtacaacctcgacgtctccgtcagcggcgccagcgactggacggtgacgatg
aacgtgccgtccccggcgaaggtcctgtcgacctggaacgtcaacgccagctatcccagt
gcgcagacgctgaccgccaggtcgaacggcagcggcaacaactggggcgccaccatccag
gccaacggcaactggacctggcccagcgtgtcctgcagcgcgggctga

DBGET integrated database retrieval system