KEGG   Streptomyces coelicolor: SCO2393Help
Entry
SCO2393           CDS       T00085                                 

Gene name
SC4A7.21
Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
sco  Streptomyces coelicolor
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sco00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sco00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
2564900..2565871
Genome map
AA seq 323 aa AA seqDB search
MSELFGTLSDGTPVHRWTLERAGVRVRVLSYGGIVQSAEVPDRDGHTADVVLGFADLDGY
VAHPEPYFGALVGRYANRIAGGRFPLDGRTYALAPNEGPNTLHGGTRGFDKRVWDVAAVE
EGVRLSRVSPHGEEGFPGRLEMSVTYTLDGSGALRIAYEAVTDAPTVLNPTNHSYFNLSG
SGHAGGHELRLAASRITPVDAGLIPTGGLDDVTDTRFDFRRARKVGSGYDHNYVLDKGVT
EAAEKVAELYDPASGRVLTVATTEPGLQLYTADHLGEPFAPGDGIALETQHFPDSPNRPG
FPSTVLRPGEVFRSETVYGFSVR
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaactcttcggcacactttccgacggcaccccggtacaccgctggaccctggag
cgggccggcgtccgggtacgggtcctgtcgtacggcgggatcgtgcagtcggccgaggtg
cccgaccgggacggtcacaccgccgacgtggtcctggggttcgcggacctggacggctat
gtggcgcacccggagccgtacttcggcgcgctggtcgggcggtacgccaaccggatcgcg
ggcgggcgcttcccgctggacggccggacgtacgcgctggcgcccaacgaggggcccaac
acgctgcacggcggcacccggggcttcgacaagcgcgtgtgggacgtggcggcggtcgag
gagggcgtccggctgagccgggtctccccgcacggcgaggagggctttccggggcggctg
gagatgtcggtgacgtacacgctggacgggtcgggcgcgctgcggatcgcctacgaggcg
gtcacggacgcgccgaccgtgctgaacccgaccaaccacagctacttcaacctgagcggc
tccgggcacgcgggcgggcacgaactgcggctggccgcctcccggatcacgccggtcgac
gccggcctgatcccgaccggcggcctcgacgacgtgacggacacgcgcttcgacttccgg
cgggcgcgcaaggtcggctcgggctacgaccacaactacgtcctggacaagggtgtgacc
gaggccgccgaaaaggtcgccgagctgtacgacccggcgtcgggacgggtgctcacggtg
gcgacgaccgagccgggcctccagctgtacaccgccgaccacctgggcgagccgttcgcc
cccggggacgggatcgcgctggagacccagcacttccccgactccccgaaccggcccggc
ttcccgagcacggtgctgcggccgggcgaggtgttccgctcggagacggtgtacggcttc
tcggtgcggtag

DBGET integrated database retrieval system