KEGG   Streptomyces coelicolor: SCO2393Help
Entry
SCO2393           CDS       T00085                                 

Gene name
SC4A7.21
Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
sco  Streptomyces coelicolor
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO2393 (SC4A7.21)
   00052 Galactose metabolism
    SCO2393 (SC4A7.21)
Enzymes [BR:sco01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SCO2393 (SC4A7.21)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
2564900..2565871
Genome map
AA seq 323 aa AA seqDB search
MSELFGTLSDGTPVHRWTLERAGVRVRVLSYGGIVQSAEVPDRDGHTADVVLGFADLDGY
VAHPEPYFGALVGRYANRIAGGRFPLDGRTYALAPNEGPNTLHGGTRGFDKRVWDVAAVE
EGVRLSRVSPHGEEGFPGRLEMSVTYTLDGSGALRIAYEAVTDAPTVLNPTNHSYFNLSG
SGHAGGHELRLAASRITPVDAGLIPTGGLDDVTDTRFDFRRARKVGSGYDHNYVLDKGVT
EAAEKVAELYDPASGRVLTVATTEPGLQLYTADHLGEPFAPGDGIALETQHFPDSPNRPG
FPSTVLRPGEVFRSETVYGFSVR
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaactcttcggcacactttccgacggcaccccggtacaccgctggaccctggag
cgggccggcgtccgggtacgggtcctgtcgtacggcgggatcgtgcagtcggccgaggtg
cccgaccgggacggtcacaccgccgacgtggtcctggggttcgcggacctggacggctat
gtggcgcacccggagccgtacttcggcgcgctggtcgggcggtacgccaaccggatcgcg
ggcgggcgcttcccgctggacggccggacgtacgcgctggcgcccaacgaggggcccaac
acgctgcacggcggcacccggggcttcgacaagcgcgtgtgggacgtggcggcggtcgag
gagggcgtccggctgagccgggtctccccgcacggcgaggagggctttccggggcggctg
gagatgtcggtgacgtacacgctggacgggtcgggcgcgctgcggatcgcctacgaggcg
gtcacggacgcgccgaccgtgctgaacccgaccaaccacagctacttcaacctgagcggc
tccgggcacgcgggcgggcacgaactgcggctggccgcctcccggatcacgccggtcgac
gccggcctgatcccgaccggcggcctcgacgacgtgacggacacgcgcttcgacttccgg
cgggcgcgcaaggtcggctcgggctacgaccacaactacgtcctggacaagggtgtgacc
gaggccgccgaaaaggtcgccgagctgtacgacccggcgtcgggacgggtgctcacggtg
gcgacgaccgagccgggcctccagctgtacaccgccgaccacctgggcgagccgttcgcc
cccggggacgggatcgcgctggagacccagcacttccccgactccccgaaccggcccggc
ttcccgagcacggtgctgcggccgggcgaggtgttccgctcggagacggtgtacggcttc
tcggtgcggtag

DBGET integrated database retrieval system