KEGG   Streptomyces coelicolor: SCO2407Help
Entry
SCO2407           CDS       T00085                                 

Gene name
SC4A7.35
Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
sco  Streptomyces coelicolor
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO2407 (SC4A7.35)
   00052 Galactose metabolism
    SCO2407 (SC4A7.35)
Enzymes [BR:sco01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SCO2407 (SC4A7.35)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
2579862..2580962
Genome map
AA seq 366 aa AA seqDB search
MAATAVGGTAHASGGRKPVKELFGRLADGTKVYRWSLENGGTRMKVLSYGGVVESLEIPD
RRGRYANVSLGFDNLDDYVARSPHFGALIGRYGNRIAKGRFTLDGKEYQLSVNDGENSLH
GGALGFDYRVWDVEPFTHGSDTGLVLHYTSVDGEMGYPGTLRAKVTYTLTRRGDWRIDYE
ATTDKATVVNLTSHVYWNLAGEGSGTIEDHELSIAASRFTPTDAGLIPTGELARVSGTPF
DFRRAKPIGRDIRDAHPQLVTAKGFDHNWVLDKGITDRPEHIATLRENASGRTLRIATDQ
PGLQFYSGNFLDGTLTGTGGSLYRQGDALCLETQHFPDSPNQPSFPSTVLRPGETYRTST
VHSFDA
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
gtggccgccaccgcggtcggcggcacggcgcacgcctcgggaggcaggaaacccgtgaag
gaactcttcggcaggctcgccgacgggacgaaggtgtaccgctggtcgctggagaacggc
ggcacgcggatgaaggtgctgtcgtacggcggcgtcgtggagtccctggagatcccggac
cgccggggccgctacgccaacgtctcgctgggcttcgacaacctcgacgactacgtcgcc
cgcagcccgcacttcggcgccctgatcgggcggtacggcaaccgcatcgccaagggccgt
ttcaccctggacggcaaggagtaccagctctccgtcaacgacggggagaactccctgcac
ggcggcgccctcggcttcgactaccgggtctgggacgtcgagcccttcacccacggctcg
gacaccggcctggtgctccactacaccagcgtcgacggcgagatgggctacccgggcacg
ctcagggcgaaggtgacgtacaccctcacccggcgcggcgactggcgcatcgactacgag
gccaccaccgacaaggccaccgtcgtcaacctcaccagccacgtctactggaacctggcc
ggcgagggcagcggcacgatcgaggaccacgagctgtcgatcgccgcctcccgcttcacc
cccaccgacgcgggcctgatccccaccggagaactggcccgggtgtccggcacgcccttc
gacttccgccgggccaagccgatcggccgggacatccgggacgcccacccgcagctggtc
accgccaagggcttcgaccacaactgggtgctcgacaagggcatcaccgaccgccccgag
cacatcgccaccctgcgcgagaacgcctccggccgcaccctgcgcatcgccaccgaccag
cccggactccagttctactcgggcaacttcctcgacggcaccctgaccggcaccggcggc
tccctctaccgccagggcgacgccctgtgcctggagacgcagcacttcccggactcgccg
aaccagccgtcgttcccgtcgaccgtgctgcggcccggcgagacctaccggacgtcgacg
gtgcactccttcgacgcctag

DBGET integrated database retrieval system