KEGG   Streptomyces coelicolor: SCO2649Help
Entry
SCO2649           CDS       T00085                                 

Gene name
SC8E4A.19c
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sco  Streptomyces coelicolor
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SCO2649 (SC8E4A.19c)
Enzymes [BR:sco01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     SCO2649 (SC8E4A.19c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(2880455..2882590)
Genome map
AA seq 711 aa AA seqDB search
MPAAQPAEPPAEDLPEDLTRLAALHGVATSYRPSPDRTVPATATAVTLALAALGVDASSP
GAVRAALTARETELRGRLLPPTVVRWDGGGTPAALAALPAGTRLRVDTEQGERLDGVGRL
PHGVHRLTATAPDGRTADAHLIVAPARLPAPAVRSYGLLVQLYSLLSRRSWGMGDLGDLG
ELAAWAGRSLGAGFVQVNPLHAAVPGAPADPSPYRPSSRRFPDPVHLRIEDVPEFAYVTD
HERARSLRERAGRLREGVLEKDALIDRDAVWELKREALELLHEVPLGPGRRAAYCDYLAE
QGTALEDHATWCALAEVHGSDWHRWPEGLRDPRSAGTDRARRELMDRVDLHSRLTWLTDT
QLTAAQRTAREAGMPVGIVHDLAVGVHPRGADSWAQQEYFAAGMSVGAPPDAFNSRGQDW
GLPPWRPDRLAASGYAPFRGLLRGLFRYAGALRVDHVMGLFRLWWVPEGRPPTEGTYVHY
DAEAMLAVLVLEAARAGAVVIGEDLGTVEPGVREALRERGVLGTSVLWFERDWTGDGRPL
PPERWRADCLATATTHDLPSTAARLTGEHVELRDRLGLLARPLEEERAEAAADTAEWLDV
LSRLGLLHGTGGDTGTPAEEAEIQAVHRFLLRTPARLVGLWLPDAVGDRRPQNLPGTWDQ
YPNWRLPVADAGGRPVTLEELAASPRLHALIDVVRDAARAAVPERGGVRDG
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcagcccagccggccgagccccccgccgaggaccttcccgaggatctgaccagg
ctcgccgccctgcacggcgtcgccacctcctaccgcccctccccggaccgcaccgtcccg
gccacggccaccgccgtcaccctcgcgctggccgccctcggcgtggacgcgagcagcccc
ggggccgtacgggccgcgctcaccgcccgcgagaccgagctgcgcggacggctgctgccg
cccaccgtcgtccgctgggacggcggcggcaccccggccgcgctggccgccctgccggcg
ggcacccggctgcgcgtcgacaccgagcagggcgagcggctcgacggcgtcgggcggctt
ccgcacggagtgcaccggctgaccgccaccgcacccgacgggcgtaccgccgacgcacac
ctgatcgtcgcgcccgcccggctgcccgccccggccgtgcgctcctacggcctcctcgtc
cagctctactccctcctctcccgccgctcctggggcatgggcgacctcggcgacctcggt
gaactggccgcctgggccggtcgctccctcggcgccggattcgtccaggtcaacccgttg
cacgcggccgtacccggtgcccccgccgacccgtcgccgtaccggccgtcctcgcgccgc
ttccccgacccggtgcatctgcggatcgaggacgtgcccgagttcgcgtacgtcaccgac
cacgagcgcgcccggtccctgagggagcgggccgggcggctgcgcgagggcgtgctggag
aaggacgccctgatcgaccgggacgccgtgtgggagctgaagcgcgaggccctggaactg
ctccacgaggtccccctgggccccggccgccgcgccgcctactgcgactacctcgccgaa
cagggcaccgccctggaggaccacgccacctggtgcgcgctcgccgaggtccacggctcc
gactggcaccgctggcccgagggcctgcgcgacccccgctcggccggcaccgaccgcgcc
cgccgcgagctgatggaccgcgtcgacctccactcccgcctcacctggctcaccgacacc
cagctgaccgccgcccagcgcaccgcccgcgaggcgggcatgccggtggggatcgtccac
gacctcgccgtcggcgtgcacccgcgcggtgccgactcctgggcccagcaggagtacttc
gccgcggggatgtcggtgggagcgccgcccgacgccttcaactcccgcggccaggactgg
gggttgccgccctggcgcccggaccgcctggccgcgtccgggtacgcgccgttccgggga
ctgctgcgcggcctgttccggtacgccggggcgctgcgcgtcgaccacgtcatgggcctg
ttccggctctggtgggtgcccgagggccggccgcccaccgagggcacctacgtccactac
gacgccgaggccatgctcgccgtcctcgtcctggaggccgcccgggccggtgccgtcgtc
atcggcgaggacctgggcaccgtggagcccggggtgcgcgaggcgctgcgcgagcgcggg
gtgctgggcacctcggtgctgtggttcgaacgggactggaccggcgacggccgccctctg
ccgcccgagcggtggcgcgccgactgcctggccaccgccaccacgcacgacctgccgtcc
accgcggcccgactcaccggcgaacacgtcgaactgcgcgaccggctcggcctgctcgcc
cgcccgctggaggaggagcgcgccgaggccgcggcggacaccgcggagtggctcgacgta
ctgagccggctcgggctgctgcacggcaccggcggcgacaccggaacgcccgccgaggag
gcggagatccaggccgtgcaccgcttcctgctgcgcactcccgcccgcctggtcggcctc
tggctcccggacgccgtcggcgaccgccgcccgcagaacctgcccggcacctgggaccag
tacccgaactggcggctgcccgtcgccgacgccgggggccgcccggtgacgctggaggag
ctggccgcctcgccccggctgcacgcgctgatcgacgtcgtgcgcgatgccgcacgcgcc
gccgtacccgagcgcggcggcgtccgggacggctga

DBGET integrated database retrieval system