KEGG   Streptomyces coelicolor: SCO2657Help
Entry
SCO2657           CDS       T00085                                 

Gene name
SC8E4A.27
Definition
transcriptional regulator
Organism
sco  Streptomyces coelicolor
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
2888297..2889526
Genome map
AA seq 409 aa AA seqDB search
MWTRMAGTAGTPGTPRVLRAMNDRAALDLLLEHGPLSRTRIGKLTGLSKPTASQLLARLE
AAGLVLAGGTTEGRPGPGAQLYEVNPAAAYAAGIDVTPDRVLAAVADVTGRTVGRYELPT
PGRRAATPVVQQVTDALDGAVKAAGLARDDVHRLVIGTPGAFDPGTGRLRYASHLPGWHS
PALLEELAAALPMPVEYENDVNLAAVAEQRLGAARGHEDFVLLWNQEGLGAALVLGGRLH
RGWTGGAGEVGFLPVPGAPLVRKVSRTGSGGFQELAGSQALAGLARELGVTDVPSGPYPE
VAATLVARAARADAADGPHRRLLQTYATRLATGLASLVSVLDPELVVLSGTSLTAGGEAL
RDLVRDELEELAASRPRLAVGDVTEHPVLRGALESALATTRDEVFDTSR
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
gtgtggacacgcatggcaggaaccgccggtacgccgggcaccccgcgcgtcctgcgcgcc
atgaacgaccgggccgcactcgacctcctgctggagcacggaccgctgtcccggacccgg
atcggcaagctgaccggcctgtcgaagccgaccgcctcccagttgctggcccgcctggag
gcggcggggctggtcctggccggggggacgaccgaagggcgccccgggcccggcgcccag
ctctacgaggtcaacccggccgccgcgtacgccgccgggatcgacgtcaccccggaccgc
gtcctcgccgcggtcgccgacgtcaccgggcgcaccgtcggccggtacgagctgcccacc
ccgggccgacgcgccgccacccccgtcgtccagcaggtcaccgacgccctcgacggcgcg
gtgaaagcggccggactcgcccgcgacgacgtccaccgcctggtcatcggcacgccgggc
gccttcgacccgggtaccgggcggctgcgctacgcctcccacctgcccggctggcactcc
cccgccctcctggaggaactcgccgccgcactgccgatgccggtcgagtacgagaacgac
gtgaacctcgccgccgtggccgagcagcgcctcggcgcggcccggggccacgaggacttc
gtcctgctgtggaaccaggaggggctgggcgccgccctggtcctcggtggccggctgcac
cgcggctggaccggcggcgccggcgaggtcgggttcctgccggtgcccggcgcccccctg
gtccgcaaggtcagccgcaccggcagcggcggcttccaggagctggccggctcccaggcc
ctggcgggactggcccgggagctgggggtcaccgacgtgccgtcggggccgtaccccgag
gtcgccgccaccctggtggcccgcgcggcgcgggccgacgccgcggacggaccgcaccgc
cggctgctccagacctacgccacccgcctggccaccggcctcgcctccctcgtctcggtc
ctggaccccgagctggtggtcctgagcggcacctccctcaccgcgggcggcgaggcgctg
cgcgacctggtccgggacgagctggaggagttggccgcctcccggccccggctcgccgtc
ggcgacgtgaccgaacaccccgtcctgcgcggcgcgctggagagtgcgctcgcgaccacc
cgcgacgaggtcttcgacacctcgcgctga

DBGET integrated database retrieval system