KEGG   Streptomyces coelicolor: SCO2700Help
Entry
SCO2700           CDS       T00085                                 

Gene name
melC2, SCC61A.21c
Definition
tyrosinase
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
sco  Streptomyces coelicolor
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:sco00350]
Metabolism; Metabolism of cofactors and vitamins; Riboflavin metabolism [PATH:sco00740]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(2943456..2944322)
Genome map
AA seq 288 aa AA seqDB search
MAYTRKDVSTLTRTEKRRFVNALLEIKRRGEYDEFVRTHIEYYVSDGENGLRTAHMAPSF
LPWHRRFLLDLEEALRRVDPSVTVPYWDWTKDRSAKSAPWTADLLGGTGRRSDHRVTTGP
FAHAGGNWTIKVNVTDTEYLTRDLGRAADPLGLPTKSDLEWALDDPKYDTSPYDSTVRKG
FRNKLEGWGAGRGSVSWRNHNRVHRWVGGAMVGGASVNDPVFWLHHAFIDLQWSRWQARH
RGARYLPAEPPGRGSAQRGRIVARHEKLPPWDVTPDELEDVGRIYRYA
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggcgtacacgcgtaaggacgtcagcacgctgacccgcaccgagaagcggcggttcgtc
aacgcgctgctggagatcaaacgacgcggggagtacgacgagttcgtgcgcacccacatc
gagtactacgtctccgacggcgagaacggcctgcgtacggcgcacatggcgccgtccttc
ctgccctggcaccgccggttcctgctggacctggaggaggcgctgcgccgggtcgacccg
tcggtcacggtgccgtactgggactggacgaaggaccgcagcgccaagtcggcgccctgg
accgcagacctcctcggcggcaccgggcgacggtccgaccaccgggtgaccaccggcccc
ttcgcccacgccggggggaactggaccatcaaggtgaacgtcaccgacaccgagtacctc
acccgggacctgggacgtgccgccgaccccctcggcctgcccaccaagagcgacctggag
tgggcgctggacgacccgaagtacgacacctcgccctacgactccacggtccgcaagggg
ttccgcaacaagctggaggggtggggggcgggccgcggcagcgtgtcctggcgcaaccac
aaccgggtccaccgctgggtcggcggggccatggtcggcggcgcctccgtcaacgacccg
gtgttctggctgcaccacgccttcatcgacctccagtggtcccgctggcaggcccgccac
cgcggcgcccgctacctgcccgccgagccgcccggccggggcagcgcacagcgcggacgg
atcgtcgcacggcacgagaagctgccgccgtgggacgtgacaccggacgaactggaggac
gtcggccggatctaccgctacgcctga

DBGET integrated database retrieval system