KEGG   Streptomyces coelicolor: SCO2700Help
Entry
SCO2700           CDS       T00085                                 

Gene name
melC2, SCC61A.21c
Definition
tyrosinase
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
sco  Streptomyces coelicolor
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    SCO2700 (melC2)
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    SCO2700 (melC2)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     SCO2700 (melC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(2943456..2944322)
Genome map
AA seq 288 aa AA seqDB search
MAYTRKDVSTLTRTEKRRFVNALLEIKRRGEYDEFVRTHIEYYVSDGENGLRTAHMAPSF
LPWHRRFLLDLEEALRRVDPSVTVPYWDWTKDRSAKSAPWTADLLGGTGRRSDHRVTTGP
FAHAGGNWTIKVNVTDTEYLTRDLGRAADPLGLPTKSDLEWALDDPKYDTSPYDSTVRKG
FRNKLEGWGAGRGSVSWRNHNRVHRWVGGAMVGGASVNDPVFWLHHAFIDLQWSRWQARH
RGARYLPAEPPGRGSAQRGRIVARHEKLPPWDVTPDELEDVGRIYRYA
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggcgtacacgcgtaaggacgtcagcacgctgacccgcaccgagaagcggcggttcgtc
aacgcgctgctggagatcaaacgacgcggggagtacgacgagttcgtgcgcacccacatc
gagtactacgtctccgacggcgagaacggcctgcgtacggcgcacatggcgccgtccttc
ctgccctggcaccgccggttcctgctggacctggaggaggcgctgcgccgggtcgacccg
tcggtcacggtgccgtactgggactggacgaaggaccgcagcgccaagtcggcgccctgg
accgcagacctcctcggcggcaccgggcgacggtccgaccaccgggtgaccaccggcccc
ttcgcccacgccggggggaactggaccatcaaggtgaacgtcaccgacaccgagtacctc
acccgggacctgggacgtgccgccgaccccctcggcctgcccaccaagagcgacctggag
tgggcgctggacgacccgaagtacgacacctcgccctacgactccacggtccgcaagggg
ttccgcaacaagctggaggggtggggggcgggccgcggcagcgtgtcctggcgcaaccac
aaccgggtccaccgctgggtcggcggggccatggtcggcggcgcctccgtcaacgacccg
gtgttctggctgcaccacgccttcatcgacctccagtggtcccgctggcaggcccgccac
cgcggcgcccgctacctgcccgccgagccgcccggccggggcagcgcacagcgcggacgg
atcgtcgcacggcacgagaagctgccgccgtgggacgtgacaccggacgaactggaggac
gtcggccggatctaccgctacgcctga

DBGET integrated database retrieval system