KEGG   Streptomyces coelicolor: SCO2737Help
Entry
SCO2737           CDS       T00085                                 

Gene name
SCC57A.08c
Definition
deoxyribonuclease
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sco  Streptomyces coelicolor
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sco03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(2984296..2986557)
Genome map
AA seq 753 aa AA seqDB search
MPTQPPAAPGERRLATLEGVLERVTYANEENGYTVARVDTGRGAGDLLTVVGALLGAQVG
ESLRMEGRWGSHPQYGKQFHVENYTTLLPATVQGIRRYLGSGLVKGIGPIFADRITQHFG
LDTLTIIEEEPKRLIEVPGLGPKRTKKIADAWEEQKAIKEVMLFLQTVEVSTSIAVRIYK
KYGDASISVVKNQPYRLAADVWGIGFLTADKIAQSVGIPHDSPERVKAGLQYALSQATDQ
GHCYLPEEKLIADAVKLLQVDTGLVIECLGELAAEPEDPDGDPGVVREKVPHSEGGEPVT
AVYLVPFHRAELALAGQLRRLLHTDEDRMPGFRDVAWDNALGWLKRRTGADLAPEQEEAV
KLALSEKVAVLTGGPGCGKSFTVRSIVELARAKKAKVVLAAPTGRAAKRLAELTGAEAST
VHRLLELKPGGDAAYDRERPLDADLVVVDEASMLDLLLANKLAKAVPPGAHLLLVGDVDQ
LPSVGAGEVLRDLLAPGSPVPAVRLTRVFRQAQQSGVVTNAHRINAGQHPLTDGMKDFFL
FVEDDTEEAGRLTVDVAARRIPAKFGLDPRRDVQVLAPMHRGPAGAGTLNGLLQQAVTPG
RPDVPEKRFGGRVFRVGDKVTQIRNNYEKGENGVFNGTVGVVTSLDPVDQRLTVLTDEDE
EVPYDFDELDELAHAYAVTIHRSQGSEYPAVVIPVTTGAWMMLQRNLLYTAVTRAKRLVV
LVGSRKAIGQAVRTVSAGRRCTALDFRLAGPRT
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atgcccacccagccccccgcggcccccggcgagcggcggctcgccaccctcgaaggcgtc
ctggagcgtgtcacgtacgccaacgaggagaacggctacaccgtcgcccgcgtcgacacc
ggcagaggcgccggcgatctgctgaccgtcgtcggcgcgctgctcggcgcgcaggtgggg
gagtcgctgcggatggaggggcgctgggggtcgcacccccagtacggcaagcagttccac
gtggagaactacacgacgctgctccccgccaccgtgcagggcatccggcgctatctgggg
tccgggctggtcaagggcatcgggccgatcttcgccgaccggatcacgcagcacttcggg
ctggacaccctcacgatcatcgaggaggagcccaagcggctcatcgaggtgcccggcctc
gggcccaagcggaccaagaagatcgccgacgcctgggaggagcagaaggcgatcaaggag
gtcatgctcttcctccagaccgtcgaggtgtccacctccatcgcggtgcggatctacaag
aagtacggggacgcatcgatctccgtcgtgaagaaccagccctaccggctcgccgccgat
gtgtggggcatcggcttcctcaccgccgacaagatcgcccagtccgtagggatcccgcac
gacagcccggagcgggtgaaggccggcctgcagtacgcgctgtcccaggccaccgaccag
gggcactgctacctccccgaggagaagctgatcgccgacgcggtgaagctgctccaggtg
gacaccgggctcgtcatcgagtgcctcggggagctggccgccgagcccgaggacccggac
ggcgaccccggggtcgtgcgggagaaggtgccccattccgagggcggcgagcccgtcacc
gccgtctacctcgtgcccttccaccgggccgagctggccctggcggggcagttgcggcgc
ctcctccacaccgacgaggaccggatgcccggcttccgggacgtggcctgggacaacgcg
ctcgggtggctgaagcggcgcactggcgccgacctcgcgcccgagcaggaggaggccgtc
aagctcgcgctcagcgagaaggtcgccgtgctcaccggcgggcccggctgcggcaagtcc
ttcaccgtgcggtccatcgtggagctggcgcgggccaagaaggcgaaggtcgtactggcc
gcgcccaccggccgggccgccaagcggctcgccgagctgaccggcgccgaggcgtccacc
gtgcaccgcctgctggagctgaagcccggcggtgacgccgcctacgaccgggagcggccg
ctcgacgcggacctggtggtggtggacgaggcgtcgatgctcgatctgctcctcgccaac
aagctcgcgaaagccgtcccgcccggcgcccacctgctgctcgtcggcgatgtcgaccag
ttgcccagcgtgggggcgggggaggtgctccgggacctgctggccccgggcagccccgtg
ccggccgtccgtctcacccgcgtcttccggcaggcccagcagtccggcgtcgtcaccaac
gcgcaccggatcaacgccgggcagcacccgctcaccgacgggatgaaggacttcttcctc
ttcgtcgaggacgacaccgaggaggccgggcggctcacggtggacgtcgccgcgcggcgc
atccccgcgaagttcgggctcgacccgcgccgggacgtgcaggtgctggcgccgatgcac
cggggacccgccggtgccgggacgttgaacgggctgctccagcaggccgtcaccccgggg
cgcccggacgtgcccgagaagcggttcggcggacgggtcttccgggtcggcgacaaggtc
acccagatccgcaacaattacgagaagggcgagaacggcgtcttcaacggcaccgtgggc
gtcgtcacctcgctcgacccggtcgaccagcgcctcaccgtgctgacggacgaggacgag
gaggtgccgtacgacttcgacgaactcgatgaactggcccacgcgtacgcggtcaccatc
caccggtcccaggggagcgagtacccggccgtcgtgatccccgtgacgaccggggcctgg
atgatgctccagcggaatctgctgtacacggcggtcacccgggcgaaacggctggtcgtc
ctcgtcgggtcgcgcaaggcgatcgggcaggcggtgcggacggtgtcggccgggaggcgg
tgcacggcgctcgacttccggttggcggggccccggacctga

DBGET integrated database retrieval system