KEGG   Streptomyces coelicolor: SCO2748Help
Entry
SCO2748           CDS       T00085                                 

Gene name
SCC57A.19
Definition
carbohydrate kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sco  Streptomyces coelicolor
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SCO2748 (SCC57A.19)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SCO2748 (SCC57A.19)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
2994994..2995914
Genome map
AA seq 306 aa AA seqDB search
MYDYDLLVVGSANADLVIGVERRPAAGETVLGSDLAVHPGGKGGNQAVAAARLGARTALL
ARVGDDDYGRLLLDSQRAAGVDTVGVLVGGAPTGVALITVDPSGDNSIVVSPGANGRLAP
GDVRAAASLFHASRVVSTQLEIPLETVVEVVRSLAPDSRFVLNPSPPRPLPQEVLTACDP
LIVNEHEAKVILGDSLVGERPEDWARVLLAKGPRSVVVTLGAEGALVASAAGGVVRVPSV
KVDAVDTTGAGDAFTAALAWRLGTGESLADAAAYAARVGAAAVTKAGAQESYPTAAEAED
LGAGAL
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgtacgactacgacctgctggtcgtcgggtcggccaacgccgacctggtgatcggtgtc
gagcggcggccggcggcgggcgagacggtgctcggctccgacctggccgtccacccgggc
ggcaagggcggcaaccaggccgtcgccgccgcccggctcggcgcccgtacggccctgctg
gcccgggtgggcgacgacgactacgggcggctgctgctggactcgcagcgggcggccggt
gtcgacaccgtcggcgtgctggtgggcggcgccccgaccggcgtcgcgctgatcaccgtc
gacccgtccggggacaacagcatcgtggtctcgccgggcgccaacggccggctggcgccg
ggcgacgtccgggccgcggccagcctcttccacgcctcccgggtggtctccacgcagctg
gagatcccgctggagacggtcgtggaggtggtccgctcgctcgcgccggacagccgtttc
gtgctgaacccgtcgccgccgcggccgcttccgcaggaggtgctgaccgcctgcgacccg
ctgatcgtcaacgagcacgaggcgaaggtgatcctcggcgactccctggtcggcgagcgc
cccgaggactgggcccgcgtcctgctggccaaggggccgcgctcggtggtcgtgacgctg
ggcgccgagggcgcgctggtcgcgtcggcggccgggggcgtggtccgggtgccgtcggtg
aaggtggacgccgtggacacgacgggcgccggtgacgcgttcaccgcggcgctggcctgg
cggctcggcaccggcgagtcgctcgccgacgcggcggcgtacgcggcccgggtgggcgcg
gcggcggtcacgaaggcgggggcgcaggagtcgtacccgacggcggcggaggccgaggac
ctgggggccggggcgctgtga

DBGET integrated database retrieval system