KEGG   Streptomyces coelicolor: SCO2758Help
Entry
SCO2758           CDS       T00085                                 

Gene name
nagA
Definition
beta-N-acetylglucosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sco  Streptomyces coelicolor
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SCO2758 (nagA)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    SCO2758 (nagA)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SCO2758 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
3004794..3006641
Genome map
AA seq 615 aa AA seqDB search
MHHSSTAGTGSTAQPSRRSVLTATAVVTAALAAGGGTAYADARGPDDDTLRGLISRMTLE
EKVGQLFVMRVYGHSATDPDQADIDANLEEIGVRTAAELVARYRVGGIIYFAWAHNTRDP
HQIADLSNGIQKASLEQPRGLPVLISTDQEHGIVARVGEPATLFPGAMAVGAGGSRSDAR
TLGRIAGAELHALGIRQDYSPVADVNVNPANPVIGVRSFGADPDAVAELVAAEVTGYQRS
GVAACAKHFPGHGDTATDSHTGFPVITHTREQWEELDAPPFRAAVEAGIDAIMTAHLMVP
ALDDSGDPATLSRPILTGILREELGYDGVVVTDSLGMEGVRTKYGDARVPVLALKAGVDQ
LLNPPDLPLAWNAVLAAVREGELTEARLDESILRVLRLKAKLGLFRDAYTSRRDVDRTVG
TRAHLAAADRIAERTTTLLVNEERLLPLSRRAHRRLLVVGADPASPSGTTGPPTGVLAGA
LTELGFTATALSTGTAPSAALIDRAVAAAGDADAVVVATYNVTAGSSQRTLVTRLLETGK
PVVAVAVRNPYDVAQLPGVPAFLAAYSWTDVEVRAAARVIAGRVRPRGKLPVPVVRADDP
DTVLLPLGHGLTYRS
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
gtgcaccacagcagcacggccggcacgggaagcaccgcacagccctccagacgtagcgtc
ctcaccgccaccgcggtcgtcaccgcggccctcgcggccgggggcggtacggcctacgcc
gacgcccgcgggcccgacgacgacacgctccgcggcctgatctcccgcatgacgctggag
gagaaggtcgggcagctcttcgtcatgcgggtctacggccactccgccaccgaccccgac
caggccgacatcgacgccaacctcgaggagatcggcgtccgcaccgccgccgagctggtc
gccaggtaccgggtcggcggcatcatctacttcgcctgggcgcacaacacccgcgacccg
caccagatcgccgacctgtccaacggcatccagaaggcctccctggagcagccgcgcggt
ctgcccgtgctcatctcgaccgaccaggagcacggcatagtggcccgcgtgggcgagccc
gccaccctcttcccgggcgcgatggccgtcggggcgggcgggtcgcggtccgacgcccgt
acgctcggccggatcgcgggcgccgagctgcacgccctgggcatccgccaggactactcc
cccgtcgccgacgtgaacgtcaacccggccaaccccgtgatcggcgtacggtccttcggc
gccgacccggacgcggtggcggagctggtggcggcggaggtgacggggtaccagcgctcg
ggcgtcgccgcgtgcgccaagcacttccccgggcacggcgacaccgccaccgacagccac
accggtttcccggtcatcacgcacacccgggagcagtgggaggagctggacgcgccgccc
ttccgcgcggcggtcgaggccggcatcgacgccatcatgaccgcccacctgatggtcccg
gcgctcgacgactccggcgacccggccaccctctcccgtccgatcctcaccggcatcctg
cgcgaggagctgggatacgacggggtcgtggtcaccgactccctcggcatggagggcgtg
cggacgaagtacggcgacgctcgggtgccggtgctggcgctgaaggccggtgtcgaccag
ctgctcaacccgccggacctgccgctcgcctggaacgccgtcctggcggccgtacgggag
ggcgaactcaccgaggcacggctggacgaatcgatcctgcgggtgctgcggctgaaggcc
aagctggggctgttccgggacgcgtacaccagccgccgggacgtcgaccggaccgtcggc
acccgggcgcacctggccgcggccgaccggatcgcggagcggaccacgacgctgctggtc
aacgaggagcggctgctgccgctttcgcgccgcgcacaccgcaggctgctggtggtgggc
gccgatccggcctcgccgtcgggcacgaccgggccgcccaccggtgtactcgcgggcgcg
ctgacggagctgggcttcacggccaccgccctgtccaccggcaccgcgccctccgccgcc
ctgatcgaccgcgccgtcgcggcggccggggacgccgacgcggtggtcgtcgccacgtac
aacgtgaccgcgggcagcagccagcgcaccctggtcacgcggctgctggagaccgggaag
ccggtcgtcgcggtcgccgtccgcaacccgtacgacgtcgcccagctccccggcgttccc
gccttcctcgccgcgtactcctggaccgacgtggaggtgcgcgcggcggcccgggtgatc
gccgggcgggttcggccgcgcgggaagctgccggtgccggtggtgcgcgcggacgacccg
gacacggtgctcctcccgctcggacacgggctgacctaccggtcgtag

DBGET integrated database retrieval system