KEGG   Streptomyces coelicolor: SCO2770Help
Entry
SCO2770           CDS       T00085                                 

Gene name
SCC105.01c, SCC57A.41c, speB
Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
sco  Streptomyces coelicolor
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SCO2770 (SCC105.01c)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     SCO2770 (SCC105.01c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(3021658..3022626)
Genome map
AA seq 322 aa AA seqDB search
MSSNETPRGPVDSSRIPRYAGPATFARLPRLDEVGAADVAVVGVPFDSGVSYRPGARFGG
NAIREASRLLRPYNPAQDASPFALAQVADGGDIAVNPFNIHEAVETIEAAADDLLGTGAR
LMTLGGDHTIALPLLRSVAKKHGPVALLHFDAHLDTWDTYFGAEYTHGTPFRRAVEEGVL
DTSALSHVGTRGPLYGKKDLTDDEKMGFGIVTSADVYRRGADEIADQLRQRIGDRPLYIS
IDIDCLDPAHAPGTGTPEAGGMTSRELLEILRGLASCNLVSADVVEVAPAYDHAEITSVA
ASHTAYELTTIMSRQIAEARTK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaacgagacgccccgcggtcccgtcgactcctcccggatcccgcggtacgcc
gggcccgcgaccttcgcccggctcccgcgcctggacgaggtcggcgccgccgacgtcgcc
gtcgtgggcgtgccgttcgactcgggcgtctcctaccggcccggcgcccgcttcggcggc
aacgccatccgcgaggcctcccgcctgctgcgcccctacaacccggcgcaggacgcctcc
cccttcgccctcgcccaggtcgcggacggcggcgacatcgccgtgaacccgttcaacatc
cacgaggccgtcgagacgatcgaggccgccgccgacgacctcctcggcaccggcgcccgc
ctgatgaccctgggcggcgaccacaccatcgccctgccgctgctccgctcggtcgccaag
aagcacggccccgtcgccctgctccacttcgacgcccacctggacacctgggacacctac
ttcggcgccgagtacacgcacggcacccccttccggcgggcggtggaggagggcgtcctc
gacacctcggccctctcccacgtcggcacccgcggtcccctgtacggcaagaaggacctc
accgacgacgagaagatgggcttcggcatcgtcacgtcggcggacgtctaccgccgcggc
gccgacgagatcgccgaccagctcaggcagcgcatcggggaccgcccgctgtacatctcc
atcgacatcgactgcctcgaccccgcccacgcccccggcaccggcacccccgaggccggc
ggcatgacctcccgcgagctgctggagatcctgcgcggcctggcctcctgcaacctggtc
tccgccgacgtcgtcgaggtggctcccgcctacgaccacgcggagatcacgtcggtggcc
gcgtcccacaccgcctacgaactgaccacgatcatgtcccgccagatcgccgaggcgcgt
acgaagtga

DBGET integrated database retrieval system