KEGG   Streptomyces coelicolor: SCO2786Help
Entry
SCO2786           CDS       T00085                                 

Gene name
hexA, SCC105.17c
Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
sco  Streptomyces coelicolor
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sco00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:sco00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3040752..3042359)
Genome map
AA seq 535 aa AA seqDB search
MRPHRRHHRTTPRITRLLGSLLLVAAVGAMTTGAAPVRKAAAEPTPLDRVIPAPASVEPG
GAPYRITRGTHIRVDDSREARRVGDYLADLLRPATGYRLPVTSHGHGGIRLRLAEGPYGD
EGYRLDSGREGVTITARKAAGLFHGVQTLRQLLPAAVEKDSAQPGPWLVAGGTIEDTPRY
AWRSAMLDVSRHFFSVDEVKRYIDRVALYKYNKLHLHISDDQGWRLAIDSWPRLATYGGS
TEVGGGPGGHYTKADYEEIVRYAASRHLEVVPEIDMPGHTNAALASYAELNCDGVAPPLY
TGTKVGFSTLCVDKDVTYDFVDDVLGELAALTPGRYLHIGGDEAHSTPQADFVAFMKRVQ
PIVAKYGKTVVGWHQLAGAEPVEGALVQYWGLDRTSDAEKAQVAAAARNGTGLILSPADR
TYLDMKYTKDTPLGLSWAGYVEVRRSYDWDPAAYLPGAPAEAVRGVEAPLWTETLSDPDQ
LDFMAFPRLPGVAELGWSPASTHDWDTYKVRLAGQAPHWEAMGIDYYRSPQVPWT
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
gtgagacctcatcgacggcaccacagaacgactccccgcatcacccggctgttgggatcg
ctgctgctggtggcggcggtcggcgccatgaccaccggcgccgccccggtccggaaggcg
gccgcggaaccgacccccctggaccgggtgatcccggccccggcctcggtcgaacccggc
ggcgccccgtaccgcatcacccgaggcacccacatccgcgtggacgactcccgcgaggcc
cgccgcgtcggcgactacctcgcggacctcctgcggcccgccaccggctaccggctcccc
gtcacctcccacggccacggcggcatacgactgcgcctggccgagggcccgtacggcgac
gagggctaccgcctcgacagcggacgcgagggcgtcaccatcaccgcccgcaaggccgcc
gggctcttccacggcgtccagaccctgcgtcagctgctgcccgccgccgtcgagaaggac
tccgcgcagcccggaccctggctggtcgcgggcggcaccatcgaggacaccccgcgctac
gcctggcgcagcgccatgctcgacgtctcccggcacttcttcagcgtcgacgaggtcaag
cgctacatcgaccgcgtcgccctctacaagtacaacaagctccacctgcacatcagcgac
gaccagggctggcgcctcgccatcgactcctggccgcgcctggcgacctacggcggctcc
accgaggtcggcggcggcccaggcggccactacaccaaggcggactacgaggagatcgtc
cgctacgcggcatcccgccatctggaggtcgtgcccgagatcgacatgcccggccacacc
aacgccgccctcgcctcctacgccgagctgaactgcgacggcgtggcgcccccgctctac
accggcaccaaggtcggcttcagcacgctgtgcgtggacaaggacgtcacgtacgacttc
gtggacgacgtcctcggcgaactcgccgcgctcacccccggccgctacctgcacatcggc
ggcgacgaggcgcactccacgccgcaggccgacttcgtggcgttcatgaagcgggtgcag
ccgatcgtcgccaagtacggcaagacggtcgtcggctggcaccagctggccggcgccgaa
ccggtcgagggtgcgctcgtccagtactggggcctggaccgcaccagcgacgccgagaag
gcccaggtcgccgcggccgccaggaacggcaccgggctgatcctctccccggccgaccgg
acgtacctggacatgaagtacaccaaggacactccgctggggctgtcctgggcgggctac
gtcgaggtgcggcggtcctacgactgggacccggccgcctatctgccgggcgccccggcc
gaggcggtccgcggcgtcgaggccccgctgtggacggagaccctgtccgacccggaccag
ctggacttcatggccttcccgaggctgccgggcgtcgccgagctgggctggtccccggcg
tcgacgcacgactgggacacctacaaggtgcggctcgccggacaggcaccgcactgggag
gcgatggggatcgactactaccgctcgccgcaggtgccctggacctga

DBGET integrated database retrieval system