KEGG   Streptomyces coelicolor: SCO2943Help
Entry
SCO2943           CDS       T00085                                 

Gene name
SCE59.02c
Definition
sugar hydrolase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
sco  Streptomyces coelicolor
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SCO2943 (SCE59.02c)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SCO2943 (SCE59.02c)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SCO2943 (SCE59.02c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(3198763..3200400)
Genome map
AA seq 545 aa AA seqDB search
MTDLTDVTDATDVIPRPRHAVAQDACFDLGPDTRLVADEGAGHTERWLRATLGAATGLPL
APGEGGGGAVRLSLDGELADEGYRLDIAPDGVRLTGGGPAGLFWGAQTLRQLLGPDAFRR
APLPGRRWRLPLGRIEDAPRFGWRGLMLDVSRHFMPKDGVLRQLDLMAAHKLNVLHFHLT
DDQGWRIEIKRHPKLTGTGSWRSRTKFGHRASPLWEDKPHGGYYTQEDIREIVAYAAARH
ITVLPEIDVPGHSQAAIAAYPELGNTDVIDTTALSVWDTWGVSPNVLAPTENTLRFYEGV
FEEVLELFPSEFVHIGGDECPKDQWRASATAQARMAELGLADEDELQSWFIQHFDTWLAG
RGRRLIGWDEILEGGLAKGAAVSSWRGYAGGIAAARAGHDVVMCPEQQVYLNFREDGGED
EPVPIAFVRTLEDVYRFEPVPAELTPEESGHVIGTQANLWTEVTENQERVDYQLFPRLAA
FAEVAWSALPAPADRDYAAFERRMATHYRRLDALGVAYRPPAGPRPWQRRPGVLGRPMDG
PPPNK
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
gtgacggacctgacggacgtgacggacgcgaccgacgtgattccccggccgcggcacgcg
gtggcccaggacgcctgcttcgacctcggccccgacacccggctggtggccgacgagggc
gccgggcacaccgagcgctggctgcgcgccaccctgggcgcggccaccggcctgccgctg
gcgcccggtgaggggggcggcggcgccgtccggctgtccctcgacggggaactcgccgac
gagggctaccgcctcgacatcgcacccgacggcgtacggctcaccggcggcggtcccgcc
ggactcttctggggcgcccagaccctgcgccagctgctcggaccggacgccttccggcgc
gccccgctgcccggccgccggtggcggctgccgctgggccgcatcgaggacgcgccccgc
ttcggctggcgcggactgatgctggacgtctcgcggcacttcatgccgaaggacggcgtc
ctgcgccagctggacctgatggccgcccacaaactcaacgtcctgcacttccacctgacg
gacgaccagggctggcgcatcgagatcaaacgccacccgaagctcaccggaaccggctcc
tggcgctcccggacgaaattcggtcaccgggcctcgccgctgtgggaggacaaaccccac
ggcggctactacacgcaggaggacatccgggagatcgtcgcctacgcggccgcgcggcac
atcaccgtcctccccgaaatcgacgtgcccggacactcgcaggcggccatcgcggcgtat
ccggaactcggcaacaccgatgtgatcgacaccaccgcgctctccgtctgggacacctgg
ggcgtatccccgaacgtcctcgcccccaccgagaacacgctgcgcttctacgagggcgtg
ttcgaggaagtcctggagcttttcccctccgagttcgtccacatcggcggcgacgaatgc
cccaaggaccagtggcgggcctcggccaccgcgcaggcgcggatggcggaactcggcctc
gccgacgaggacgaactccagtcctggttcatccagcacttcgacacctggctcgccgga
cgcggacgccggctcatcggctgggacgagatcctggagggcggactcgccaagggcgcg
gccgtctcctcctggcgcggttacgcgggcgggatcgccgccgcgcgcgcgggccacgac
gtcgtgatgtgccccgagcagcaggtgtacctgaacttccgggaggacggcggcgaggac
gagcccgtgccgatcgccttcgtgcgcaccctggaggacgtctaccggttcgagccggtt
ccggcggaactgaccccggaggagtccggacacgtgatcggcacccaggcgaacctgtgg
accgaggtgacggagaaccaggagcgggtggactaccagctcttcccgcggctcgccgcc
ttcgccgaggtcgcctggagcgccctgcccgccccggccgaccgggactacgccgccttc
gagcggcggatggccacccactaccggcggctcgacgccctgggcgtcgcctaccgtccg
ccggccggtccgcggccctggcagcggcggcccggtgtgctcggccgcccgatggacggg
ccgccgccgaacaagtaa

DBGET integrated database retrieval system