KEGG   Streptomyces coelicolor: SCO2949Help
Entry
SCO2949           CDS       T00085                                 

Gene name
murA, SCE59.08
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
sco  Streptomyces coelicolor
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sco00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:sco00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
3204872..3206218
Genome map
AA seq 448 aa AA seqDB search
MTVNGADDVLLVHGGTPLEGEIRVRGAKNLVPKAMVAALLGSAPSRLRNVPDIRDVRVVR
GLLQLHGVTVRPGEEPGELVLDPTHVESANVADIDAHAGSSRIPILFCGPLLHRLGHAFI
PGLGGCDIGGRPIDFHFDVLRQFGAKIEKRADGQYLEAPQRLRGTKINLPYPSVGATEQV
LLTAVLAEGVTELSNAAVEPEIEDLICVLQKMGAIIAMDTDRTIRVTGVDELGGYTHRAL
SDRLEAASWASAALATEGNVYVRGAQQRSMMTFLNTFRKVGGAFEIDDEGIRFWHPGGRL
KSIALETDVHPGFQTDWQQPLVVALTQATGLSIVHETVYESRLGFTSALNQMGAHIQLYR
ECLGGSDCRFGQRNFLHSAVVSGPTKLEGADLVIPDLRGGFSYLIAALAAQGTSRVHGID
LINRGYENFMDKLVELGAKVELPGKALG
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcaacggcgctgatgacgtactgcttgtccacggcggaaccccgctggagggc
gagatccgggtccgcggtgcgaagaacctcgtgccgaaggcgatggtggccgccctgctg
ggcagcgcgccgagccggctgcgcaacgtgccggacatccgcgacgtgcgggtcgtacgc
ggactgctgcaactgcacggggtgaccgtccgtccgggcgaggagcccggcgagctggtg
ctcgacccgacccacgtggagagcgcgaacgtcgccgacatcgatgcccacgcgggctcg
tcgcgcatcccgatcctgttctgcggcccgctgctgcaccgcctcgggcacgccttcatc
ccgggcctgggcggctgcgacatcggcggccggcccatcgacttccacttcgacgtgctg
cggcagttcggcgcgaagatcgagaagcgggcggacggccagtacctggaggctccgcag
cggctgcgcggtacgaagatcaacctgccgtacccctccgtcggcgcgaccgagcaggtg
ctgctgaccgccgtgctcgccgagggcgtcacggagctgtccaacgcggcggtggaaccg
gagatcgaggacctgatctgcgtcctgcagaaaatgggcgcgatcatcgccatggacacc
gaccgcacgatccgcgtcaccggcgtggacgagctgggcggctacacccaccgtgccctc
tcggaccgcctggaggccgcctcctgggcctccgcggccctggccaccgagggcaacgtc
tatgtccgcggggcccagcagcgctcgatgatgacgttcctgaacaccttccggaaggtg
ggcggcgcgttcgagatcgacgacgagggcatccgcttctggcacccgggcggccgactg
aagtccatcgccctggagacggacgtgcaccccggcttccagaccgactggcagcagccc
ctggtggtggcgctgacccaggccacggggctgtccatcgtccacgagacggtctacgag
tcccggctgggcttcacctcggcgctcaaccagatgggcgcccacatccagctctaccgc
gagtgcctcggcggttccgactgccgcttcggccagcgcaacttcctgcactcggccgtc
gtctccggaccgaccaaactggagggcgccgacctggtcatccccgacctgcgcggcggc
ttctcgtacctgatcgccgccctcgcggcccagggcacctcccgggtccacggcatcgac
ctgatcaaccgcggctacgagaacttcatggacaagctcgtcgagctgggcgcgaaggtg
gaactcccgggcaaggccctgggctga

DBGET integrated database retrieval system