KEGG   Streptomyces coelicolor: SCO2958Help
Entry
SCO2958           CDS       T00085                                 

Gene name
SCE59.17c
Definition
bifunctional uroporphyrinogen-III synthetase/response regulator domain-containing protein (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sco  Streptomyces coelicolor
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SCO2958 (SCE59.17c)
Enzymes [BR:sco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     SCO2958 (SCE59.17c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(3215125..3216312)
Genome map
AA seq 395 aa AA seqDB search
MDDVSDLSGAGGVGDGARQPGHGPLAGFTVGVTAARRADELGALLGRRGATVLHAPALRI
VPLADDGELMAATKRIVDRAPDVVVATTAIGFRGWVEAADGWGLGDALLERLRTVELLAR
GPKVKGAVRAAGLTERWSPASESMAEVLDRLLEQGVAGRRIAVQLHGEPLPGFVEALREG
GAEVVGVPVYRWLPPEDLGPVDRLLDAAVSRGVDAVTFTSAPAAVSLLGRAEERGLLPEL
LAAFGHDVLPACVGPVTAVPLQAHGVDTVQPERFRLGPLVQLLCQELPARARALPVAGHR
LEIRGHAVLVDGELRTVPPAGMSLLRALARRPGWVVPRAELLRALPGTGRDEHAVETAMA
RLRTSLGTPKLIQTVVKRGYRLALDPATDAKYTTD
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggacgacgtaagcgacctgagtggcgcgggtggcgtgggcgacggggcacggcagccc
ggccacggcccgctggccgggttcaccgtgggcgtgaccgccgcccgccgggccgacgaa
ctgggcgcgctgctcgggcggcgcggggccaccgtcctgcacgccccggcgctgcggatc
gtgccgctggccgacgacggcgagctgatggccgcgaccaagcggatcgtcgaccgggcg
ccggacgtcgtcgtcgccaccaccgccatcgggttccggggctgggtcgaggccgccgac
ggctgggggctcggcgacgccctgctggagcggctgcgcacggtggaactgctggcgcgc
gggcccaaggtcaagggcgcggtacgggccgccggactgaccgagcggtggtcacccgcc
tcggagtccatggccgaggtcctggaccggctcctggagcagggcgtggcgggccgccgg
atcgccgtacagctgcacggcgagccgctgccggggttcgtggaggcgctgcgggagggc
ggggccgaggtggtgggcgtgcccgtgtaccggtggctgccgccggaggacctcggtccg
gtggaccggctgctggacgccgcggtctcgcggggcgtggacgccgtgaccttcaccagc
gcgcccgccgcggtgtccctgctgggccgggccgaggagcggggcctgctgccggagctg
ctcgccgccttcgggcacgacgtgctgcccgcctgcgtcgggccggtcaccgcggtgccg
ctccaggcgcacggcgtggacacggtccagcccgagcgcttccggctcgggccgctcgtc
cagttgctgtgccaggagctgccggcccgcgcccgtgccctgcccgtcgccgggcaccgg
ctggagatccgcggacacgcggtgctcgtcgacggggagctgcggaccgtgccgcccgcc
ggcatgtccctgctgcgcgccctcgcccggcggcccggctgggtcgtgccccgcgcggag
ctgctgcgcgccctgccgggcaccggccgcgacgaacacgccgtcgagacggccatggcc
cgcctgcgcacgtccctcggcaccccgaagctgatccagacggtggtcaaacgcggctac
cgcctcgccctggacccggccacggacgccaagtacacgaccgactga

DBGET integrated database retrieval system