KEGG   Streptomyces coelicolor: SCO3037Help
Entry
SCO3037           CDS       T00085                                 

Gene name
SCE34.18
Definition
(RefSeq) F420-0--gamma-glutamyl ligase
  KO
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
sco  Streptomyces coelicolor
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    SCO3037 (SCE34.18)
Enzymes [BR:sco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     SCO3037 (SCE34.18)
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     SCO3037 (SCE34.18)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
3323222..3324553
Genome map
AA seq 443 aa AA seqDB search
MSDETRDAAPGRRDGYRVWALPGLPEVQSGDDLAKLIAAAEPALADGDVLLVTSKIVSKA
EGRVVEAADREAAIDAETVRVVARRGPLRIVENRQGLVMAAAGVDASNTPAGTVLLLPED
PDASARGIREGLRDTLGVDVGVIVTDTFGRPWRAGLTDVAIGAAGVRVLDDLRGGTDAYG
NPLGATVVATADELAAAGDLVKGKAAGLPVAVLRGLPQVVAEDDGEGARAMVRGARDDMF
RLGTSEAVRQAVTQRRTVRAFTDEPVDPGAVRRAVAAAVTAPAPHHTTPWRFVLLESGES
RTRLLDAMRDAWIADLRRDGKSEESVAKRVRRGDVLRNAPYLVVPCLVMDGSHTYGDVRR
DAAEREMFVVATGAGVQNLLVALAGERLGSAWVSSTMFCRDVVREVLGLPDGWDPMGAVA
VGHPAEEPKARPERDAEAFIEVR
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgagacgcgcgacgccgctcccggccgccgggacggctaccgggtgtgggcc
ctgcccgggctgcccgaggtgcagtccggcgacgacctggccaagctgatcgcggccgcc
gagcccgcgctggccgacggggacgtgctgctcgtcacgtccaagatcgtgtccaaggcc
gagggccgggtcgtcgaggccgccgaccgggaggccgcgatcgacgcggagaccgtacgg
gtggtggcccggcgcggcccgctgcgcatcgtggagaaccgccagggcctggtcatggcc
gcggcgggcgtcgacgcctccaacaccccggccgggaccgtactgctgctccccgaggac
cccgacgcctccgcgcgcggtatccgcgagggactccgcgacacgctcggcgtggacgtc
ggcgtcatcgtcaccgacaccttcgggcgtccctggcgggccggactcacggacgtggcg
atcggtgccgcgggcgtccgcgtcctggacgacctgcgcggcggcacggacgcgtacggc
aatccgctcggcgccaccgtcgtcgccaccgcggacgagctggccgccgcgggcgacctg
gtcaagggcaaggccgccggcctgcccgtcgccgtcctgcgcgggctgccgcaggtggtc
gccgaggacgacggcgagggcgcgcgggcgatggtgcgcggcgcgcgcgacgacatgttc
cgcctcggcacctcggaggcggtacgccaggcggtcacccagcggcgtacggtgcgggcc
ttcacggacgagccggtcgatcccggtgccgtgcgacgggcagtggccgccgcggtgacc
gcgccggcgccgcaccacacgacgccgtggcggttcgtgctcctggagtccggggagtcc
cgcacccggctcctcgacgcgatgcgcgacgcctggatcgcggacctgcggcgcgacggc
aagagcgaggagtccgtcgccaagcgcgtacggcgcggcgacgtcctgcgcaacgcgccc
tacctcgtcgtcccctgcctggtcatggacggctcgcacacctacggggacgtgcgccgc
gacgcggccgagcgggagatgttcgtggtcgccaccggcgcgggggtgcagaacctgctc
gtcgcgctcgccggggagcggctgggctccgcgtgggtgtcctcgacgatgttctgccgg
gacgtcgtgcgggaggtgctgggtctgccggacggctgggacccgatgggggcggtggcg
gtcggccatcccgccgaggagccgaaggcccggccggagcgggacgcggaggcgttcatc
gaggtgcggtga

DBGET integrated database retrieval system