KEGG   Streptomyces coelicolor: SCO3128Help
Entry
SCO3128           CDS       T00085                                 

Gene name
SCE66.07
Definition
fatty acid desaturase (membrane)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
sco  Streptomyces coelicolor
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:sco01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:sco01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
3430174..3431184
Genome map
AA seq 336 aa AA seqDB search
MTTSSDVIPDAPQPAGDAAGPSATLGGEQKRSIEQITLLLFITLPFLALVAAVPLAWGWG
VSWLDLGLLVFFYFLGCHGITIGFHRHFTHGSFKAKRPLKIALAIAGSMAVEGPLVRWVA
DHRKHHKFSDDEGDPHSPWRYGETVPALIKGLWWAHIAWMFDEEQTPQEKYAPDLIKDPA
LRAVSRQFILWTVVSLALPALIGGLVTMSWWGAFTGFFWGSLVRVALLHHVTWSINSICH
AVGKRPFKSRDRSGNVWWLAILSCGESWHNLHHADPTSARHGVMRGQLDSSARLIRWFEQ
LGWAYDVRWPSRSRIDSRRNTDQDGARRRKETAKAA
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgagttccgatgtgatcccagacgctccgcagcccgcaggcgacgccgcgggg
ccctccgccacgctgggcggtgagcagaagcggtcgatcgaacagatcacgctgctgctg
ttcatcaccctcccgttcctcgcgctggtggcggcggtgccactggcgtggggctggggc
gtgagctggctggacctggggctgctggtcttcttctacttcctgggctgccacggcatc
accatcgggttccaccgccacttcacccacggttccttcaaggcgaagcggccgttgaag
atcgccttggcgatcgccggctcgatggcggtcgagggaccgctggtccgctgggtggcc
gaccaccgcaagcaccacaagttctccgacgacgagggcgacccgcattcgccgtggcgg
tacggcgagacggtgcccgccctaatcaagggcctgtggtgggcccacatcgcctggatg
ttcgacgaggagcagacgccgcaggagaagtacgcgccggacctgatcaaggaccccgca
ctgcgggcggtctcccgccagttcatcctgtggacggtggtgtccctggcgctgcccgcg
ctgatcggcgggctggtgacgatgtcctggtggggtgcgttcaccgggttcttctggggt
tcactcgtgcgggtggccctgctgcaccacgtgacctggtcgatcaactcgatctgccac
gccgtgggcaagcgccccttcaagtcccgggaccgctcgggcaacgtgtggtggctggcg
atcctttcctgcggcgagtcctggcacaacctgcaccacgcggacccgacctcggcgcgg
cacggggtgatgcgcggccagctcgactcgagtgcccggctgatccgctggttcgagcag
ctggggtgggcgtacgacgtgcgctggccgtcacgctcgcgtatcgattcgcgccgcaac
acggatcaggacggtgcccgccgccggaaggagacggcgaaggcggcatga

DBGET integrated database retrieval system