KEGG   Streptomyces coelicolor: SCO3398Help
Entry
SCO3398           CDS       T00085                                 

Gene name
folP, SCE9.05
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
sco  Streptomyces coelicolor
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SCO3398 (folP)
Enzymes [BR:sco01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SCO3398 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
3764143..3765009
Genome map
AA seq 288 aa AA seqDB search
MSKQTGRRRRHLAGLTAWDRCAVMGVVNVTPDSFSDGGRFFDTTAAIKHGLDLVAQGADL
VDVGGESTRPGATRVDEDEELRRVVPVVRGLASEGVTVSVDTMRASVAGQALAAGATLVN
DVSGGLADPRMIPVVADTGAPFVVMHWRGLLKDGNVKGTYADVVTEVVDELHARVDAVLD
GGIAPDRVIVDPGLGFSKDAEHDLVLLAHLDRLLTLGHPLLVAASRKRFLGRVLAGPDAA
PPPARERDAATAAVSALAAQAGAWAVRVHEVRATADAVRVARAVEGAR
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcagaccggccgccgccgacgccatctcgcgggactgaccgcatgggaccgc
tgcgcggtcatgggagtcgtcaacgtaacccccgactccttctccgacggcggccgcttc
ttcgacaccacggcggccatcaaacacggcctggacctggtcgcccagggcgccgacctc
gtggacgtgggcggcgagtccacccgccccggcgccacccgcgtcgacgaggacgaggaa
ctcaggcgcgtcgtcccggtcgtgcgcggcctcgcctccgagggcgtgacggtctccgtc
gacaccatgcgcgcctccgtcgccggccaggccctcgccgccggcgccaccctggtcaac
gacgtcagcggcggcctcgccgacccccggatgatcccggtcgtcgccgacacgggcgcc
cccttcgtcgtcatgcactggcgcggcctcctgaaggacggcaacgtcaaaggcacctac
gccgacgtcgtgacagaggtcgtcgacgaactccacgcacgcgtggacgccgtcctcgac
ggcggcatcgcacccgaccgcgtgatcgtcgaccccggcctcggcttctccaaggacgcc
gagcacgacctcgtcctcctcgcccacctcgaccgcctcctcaccctcggccaccccctc
ctcgtcgccgcctcccgcaaacgcttcctcggccgcgtcctcgccggcccggacgccgcc
ccgccccccgcgcgcgagcgcgacgcggccaccgccgcggtctccgcgctcgccgcgcag
gccggcgcgtgggcggtccgcgtccacgaggtccgcgccacggccgacgccgtccgcgtc
gcccgcgccgtcgaaggagcccggtga

  All links  
No link information was found.   
DBGET integrated database retrieval system