KEGG   Streptomyces coelicolor: SCO3401Help
Entry
SCO3401           CDS       T00085                                 

Gene name
folK, SCE9.08
Definition
hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sco  Streptomyces coelicolor
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SCO3401 (folK)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     SCO3401 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
3766170..3766781
Genome map
AA seq 203 aa AA seqDB search
MSAPFAQGPSDPTVQPVPASVIEQVDAADTTLSNPKRAVVALGANLGNRLETLQGAIDAL
EDTPGVRVKGVSPVYETEPWGVAPDSQPSYFNAVVILKTTLPPSSLLERAHAVEEAFHRV
RDERWGPRTLDVDIVAYAEVVSDDPHLTLPHPRAHERAFVLAPWLDVDPEAALPGRGRVA
DLLAAVTRDGVAPRADLELQLPE
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcccccttcgcccagggtccgagcgacccgaccgtacagcccgtgcccgcctcc
gtcatcgagcaggtcgacgccgcggacaccaccctgtccaaccccaagcgcgcggtggtc
gccctcggagccaacctcggcaaccgcctggagaccctccagggcgcgatcgacgccctg
gaggacacccccggcgtccgggtcaaaggcgtctcgccggtctacgagacggagccgtgg
ggcgtcgcccccgacagccagccctcgtacttcaacgcggtcgtgatcctcaagacgacc
ctgcccccctcctcgctcctggagcgggcgcacgcggtcgaggaggccttccaccgggtc
cgcgacgagcgctggggcccgcgcaccctggacgtcgacatcgtcgcctacgccgaggtc
gtctccgacgacccgcacctcaccctcccccacccgcgcgcccacgaacgcgccttcgtg
ctggccccctggctggacgtcgacccggaggccgccctgcccggccggggcagggtcgcc
gaccttctggccgccgtcacccgcgacggcgtcgcgccccgcgccgacctggaactccag
ctgcccgagtag

DBGET integrated database retrieval system