KEGG   Streptomyces coelicolor: SCO3636Help
Entry
SCO3636           CDS       T00085                                 

Gene name
SCH10.14c
Definition
cytochrome P-450 hydroxylase
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
sco  Streptomyces coelicolor
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    SCO3636 (SCH10.14c)
  Amino acid metabolism
   00380 Tryptophan metabolism
    SCO3636 (SCH10.14c)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SCO3636 (SCH10.14c)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     SCO3636 (SCH10.14c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(4013901..4015136)
Genome map
AA seq 411 aa AA seqDB search
MTAATDGPHVSGPAFDPWDPAFVADPYPAFAELRARGRVLYYEPSDQWLVPHHADVSALL
RDRRLGRTYQHRFTHEDFGRTPPPPEQEPFHTLNDHGMLDLEPPDHTRIRRLVSKAFTPR
TVERLKPYVHGLADDLVARLVAAGGGDLLTDVAEPLPVAVIAEMLGIPESDRAPLRPWSA
EICGMYELNPSEETAAKAVRASLDFSDYLRALIAARRKEPGDDLISGLIAAHDEDDRLTE
QEMISTCVLLLNAGHEATVNATTNGWLALFRHPDQLAALRADHSLVPSAVEELMRYDTPL
QLFERWVLDEIEIDGTTLPRGAEVAMLFGSANHDPAVFTDPERLDLTRRDNPHISFSAGI
HYCIGAPLARIELAASMTSLLKRAPGLRLAAEPERRPNFVMRGLTELRVEL
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgacggctgcaaccgatggtccccatgtgtccggtcccgcgttcgacccgtgggacccc
gccttcgtcgccgacccctaccccgccttcgccgagctgcgggcccgggggcgcgtgctc
tactacgagccgagcgaccagtggctggtcccgcaccacgcggacgtctccgcgctgctg
cgcgaccgccgcctcggccggacctaccagcaccgtttcacgcacgaggacttcggccgc
acgccgcccccgccggagcaggagcccttccacacgctcaacgaccacggcatgctcgac
ctggagccgccggaccacacccgtatccggcgcctggtgtcgaaggcgttcacgccgcgc
accgtggagcggctgaagccgtacgtgcacggcctggcggacgacctggtggcccggctg
gtggcggcgggcggcggcgatctgctcaccgacgtggccgagccgctgccggtcgccgtg
atcgccgagatgctgggcatcccggagtccgaccgggccccgctgcgcccctggtcggcg
gagatctgcgggatgtacgagctgaacccgtccgaggagacggcggcgaaggcggtccgg
gcctcgctcgacttctcggactacctgcgcgcgctgatcgcggcccgccgcaaggagccc
ggcgacgacctgatctccggtctgatcgcggcccacgacgaggacgaccgcctcaccgag
caggagatgatctcgacctgcgtcctgctcctgaacgccggtcacgaggccacggtgaac
gccaccaccaacggctggctggcgctcttccgccaccccgaccagctggccgccctgcgc
gccgaccactccctcgtcccgtcggccgtggaggagctgatgcgctacgacaccccgctc
cagcttttcgaacgttgggtcctggacgagatcgagatcgacggcacgaccctcccgcgc
ggcgcggaggtggcgatgctgttcggctcggccaaccacgacccggcggtcttcaccgac
ccggaacgcctcgacctcacccgccgcgacaacccgcacatctccttcagcgccggcatc
cactactgcatcggcgccccgctggcccgcatcgaactcgcggcgtccatgacgtccctg
ctgaagcgggcgccgggcctgcgcctggcggcggaaccggaacgcaggccgaacttcgtg
atgcgcggcctgacggagctacgcgtggaactctga

DBGET integrated database retrieval system