KEGG   Streptomyces coelicolor: SCO3636Help
Entry
SCO3636           CDS       T00085                                 

Gene name
SCH10.14c
Definition
cytochrome P-450 hydroxylase
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
sco  Streptomyces coelicolor
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:sco00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:sco00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:sco00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(4013901..4015136)
Genome map
AA seq 411 aa AA seqDB search
MTAATDGPHVSGPAFDPWDPAFVADPYPAFAELRARGRVLYYEPSDQWLVPHHADVSALL
RDRRLGRTYQHRFTHEDFGRTPPPPEQEPFHTLNDHGMLDLEPPDHTRIRRLVSKAFTPR
TVERLKPYVHGLADDLVARLVAAGGGDLLTDVAEPLPVAVIAEMLGIPESDRAPLRPWSA
EICGMYELNPSEETAAKAVRASLDFSDYLRALIAARRKEPGDDLISGLIAAHDEDDRLTE
QEMISTCVLLLNAGHEATVNATTNGWLALFRHPDQLAALRADHSLVPSAVEELMRYDTPL
QLFERWVLDEIEIDGTTLPRGAEVAMLFGSANHDPAVFTDPERLDLTRRDNPHISFSAGI
HYCIGAPLARIELAASMTSLLKRAPGLRLAAEPERRPNFVMRGLTELRVEL
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgacggctgcaaccgatggtccccatgtgtccggtcccgcgttcgacccgtgggacccc
gccttcgtcgccgacccctaccccgccttcgccgagctgcgggcccgggggcgcgtgctc
tactacgagccgagcgaccagtggctggtcccgcaccacgcggacgtctccgcgctgctg
cgcgaccgccgcctcggccggacctaccagcaccgtttcacgcacgaggacttcggccgc
acgccgcccccgccggagcaggagcccttccacacgctcaacgaccacggcatgctcgac
ctggagccgccggaccacacccgtatccggcgcctggtgtcgaaggcgttcacgccgcgc
accgtggagcggctgaagccgtacgtgcacggcctggcggacgacctggtggcccggctg
gtggcggcgggcggcggcgatctgctcaccgacgtggccgagccgctgccggtcgccgtg
atcgccgagatgctgggcatcccggagtccgaccgggccccgctgcgcccctggtcggcg
gagatctgcgggatgtacgagctgaacccgtccgaggagacggcggcgaaggcggtccgg
gcctcgctcgacttctcggactacctgcgcgcgctgatcgcggcccgccgcaaggagccc
ggcgacgacctgatctccggtctgatcgcggcccacgacgaggacgaccgcctcaccgag
caggagatgatctcgacctgcgtcctgctcctgaacgccggtcacgaggccacggtgaac
gccaccaccaacggctggctggcgctcttccgccaccccgaccagctggccgccctgcgc
gccgaccactccctcgtcccgtcggccgtggaggagctgatgcgctacgacaccccgctc
cagcttttcgaacgttgggtcctggacgagatcgagatcgacggcacgaccctcccgcgc
ggcgcggaggtggcgatgctgttcggctcggccaaccacgacccggcggtcttcaccgac
ccggaacgcctcgacctcacccgccgcgacaacccgcacatctccttcagcgccggcatc
cactactgcatcggcgccccgctggcccgcatcgaactcgcggcgtccatgacgtccctg
ctgaagcgggcgccgggcctgcgcctggcggcggaaccggaacgcaggccgaacttcgtg
atgcgcggcctgacggagctacgcgtggaactctga

DBGET integrated database retrieval system