KEGG   Streptomyces coelicolor: SCO4055Help
Entry
SCO4055           CDS       T00085                                 

Gene name
2SCD60.21c
Definition
alcohol dehydrogenase
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
sco  Streptomyces coelicolor
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO4055 (2SCD60.21c)
  Energy metabolism
   00680 Methane metabolism
    SCO4055 (2SCD60.21c)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SCO4055 (2SCD60.21c)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     SCO4055 (2SCD60.21c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(4447967..4449100)
Genome map
AA seq 377 aa AA seqDB search
MKAVVYKGPFSVAVEDVEKPDIRHPNDVIVRVTSTAICGSDLHMYEGRTAAEPGIVFGHE
NMGIVDQVGQGVTGLKKGDRVVMPFNVACGFCTNCAAGYTGYCTTVNPGFAGGAYGYVSM
GPWQGGQAEYLRVPYADFNCLKLPEGDAHETDFILLADIFPTGYHGCELADVRPGESVAV
YGAGPVGLMAAYSALLRGAKKVFVVDRVPERLQKAEEIGAVPVDFSAGDPVEQIKEQTEG
AGTDKGVDAVGYQATAGGTGKEEPATVLNSLVNTVRPTGALGVPGLYVPADPGGPDEQAK
QGMLLVAIGKLFEKGLRVGTGQCNVKRYNRQLRDMIIEGRAEPSFVVSHELPLDQAPSGY
DKFDKRIEGYTKVVLHP
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgtcgtctacaaaggaccgttctctgtcgcggtcgaggacgtcgagaagccg
gacatccggcatccgaacgacgtgatcgtgcgcgtcacctcgactgcgatctgcggctcc
gacctgcacatgtacgaggggcgcaccgcggccgagcccggcatcgtcttcggccacgag
aacatggggatcgtcgatcaggtggggcagggcgtcacgggactgaagaagggcgaccgc
gtggtcatgcccttcaacgtcgcctgcggcttctgcaccaactgcgccgcgggctacacg
ggttactgcacgaccgtcaatcccggcttcgcgggcggcgcgtacggctatgtgtccatg
ggtccctggcagggcggccaggccgagtacctgcgggtcccgtacgccgacttcaactgc
ctgaagctgcccgagggcgacgcgcacgagaccgacttcatcctgctcgccgacatcttc
ccgaccggctaccacgggtgtgaactcgccgacgtccgtcccggcgagagcgtcgccgtg
tacggggccggtccggtcgggctcatggcggcctactcggcgctgctgcgcggggcgaag
aaggtgttcgtcgtcgaccgcgtcccggagcggctgcagaaggccgaggagatcggagcg
gtgcccgtcgacttctccgcgggcgacccggtcgagcagatcaaggagcagaccgagggc
gccggcacggacaagggcgtggacgccgtcggctaccaggcgacggcgggcgggacgggc
aaggaagaaccggcgaccgtcctgaactcgctggtcaacacggtccggccgaccggagcc
ctgggcgttcccgggctctacgtcccggccgacccgggcggtccggacgagcaggccaag
cagggcatgctcctcgtcgcgatcggcaagctcttcgagaagggcctgcgggtggggacg
ggccagtgcaatgtgaagcgctacaaccggcagctgcgcgacatgatcatcgagggcagg
gcggagccgagcttcgtcgtctcccacgaactgcccctggaccaggccccgtccggctac
gacaagttcgacaagcggatcgagggctacacgaaggtggtcctgcacccctag

DBGET integrated database retrieval system