KEGG   Streptomyces coelicolor: SCO4209Help
Entry
SCO4209           CDS       T00085                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sco  Streptomyces coelicolor
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO4209 (gpmA)
   01230 Biosynthesis of amino acids
    SCO4209 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO4209 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    SCO4209 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO4209 (gpmA)
Enzymes [BR:sco01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SCO4209 (gpmA)
Exosome [BR:sco04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SCO4209 (gpmA)
  Exosomal proteins of melanoma cells
   SCO4209 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
4618020..4618781
Genome map
AA seq 253 aa AA seqDB search
MADAPYKLILLRHGESEWNEKNLFTGWVDVNLTPKGEKEATRGGELLKDAGLLPDVVHTS
VQKRAIRTAQLALEAADRHWIPVHRHWRLNERHYGALQGKDKAQTLAEFGEEQFMLWRRS
YDTPPPALDRDAEYSQFSDPRYAMLPPELRPQTECLKDVVGRMLPYWFDAIVPDLLTGRT
VLVAAHGNSLRALVKHLDGISDADIAGLNIPTGIPLSYELNAEFKPLNPGGTYLDPDAAA
AAIEAVKNQGKKK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgcaccgtacaagctgatcctcctccgccacggcgagagcgagtggaacgag
aagaacctgttcaccggctgggtggacgtcaacctcaccccgaagggcgagaaggaggcg
acgcgcggcggcgagctgctcaaggacgccggcctgctgcccgacgtggtccacacgtcc
gtccagaagcgcgcgatccgcacggcccagctcgcgctggaggccgccgaccgccactgg
atcccggtccaccgccactggcgcctgaacgagcgccactacggcgccctccagggcaag
gacaaggcccagaccctcgccgagttcggcgaggagcagttcatgctgtggcgccgctcc
tacgacaccccgccgcccgcgctggaccgcgacgccgagtactcccagttctccgacccg
cgttacgcgatgctcccgccggagctgcgcccgcagacggagtgcctgaaggacgtcgtc
ggccggatgctcccgtactggttcgacgcgatcgtccccgacctcctcaccggccgcacg
gtcctggtggcggcgcacggcaactccctccgcgccctcgtcaagcacctcgacggcatc
tccgacgccgacatcgcgggcctgaacatcccgacgggcatcccgctctcgtacgaactc
aacgccgagttcaagcccctgaacccgggcggcacgtacctcgacccggacgcggccgcg
gcggcgatcgaggccgtgaagaaccagggcaagaagaagtaa

DBGET integrated database retrieval system