KEGG   Streptomyces coelicolor: SCO4293Help
Entry
SCO4293           CDS       T00085                                 

Gene name
SCD95A.26
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sco  Streptomyces coelicolor
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCO4293 (SCD95A.26)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO4293 (SCD95A.26)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SCO4293 (SCD95A.26)
Enzymes [BR:sco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SCO4293 (SCD95A.26)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
4708607..4709893
Genome map
AA seq 428 aa AA seqDB search
MQTAETSTNPTDAAVDLGPATALSCRECGHRVPLGPVFACEECFGPLEIAYDFSDYDAEE
LRKRIEAGPANIWRYAPLLPVPADVATKPNINPGWTKLVQADNLARELGVTGGLYVKDDS
GNPTHSFKDRVVAQAIEAARAFGFTTLSCSSTGNLAGAVGAAAARAGFRSCVFIPHDLEQ
GKVVMAAVYGGELVGIEGNYDDVNRFCSELIGDPAGEGWGFVNVNLRPYYAEGSKTLAYE
ICEQLGWRLPDQIVVPIASGSQLTKIDKGLKELIELGLVEDRPYKIFGAQAEGCSPVSTA
YKAGHDVVRPQKPNTIAKSLAIGNPADGPYVLDIARRTGGAVEDVTDEQVVDAIKLLART
EGIFAETAGGVTVGVTRKLIENGVLDPSLTTVVLNTGDGLKTLDAVAGTGLTATIRPNLD
SFREAGLA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
gtgcagactgccgaaacctccacgaaccccaccgacgccgccgtcgacctcggccccgcc
accgcgctgagctgccgggagtgcggccacagggttccgctcggaccggtcttcgcctgc
gaagagtgtttcggccccctcgagatcgcctacgacttctcggactacgacgccgaagag
ctgcgcaagcggatcgaagccggccccgcgaacatctggcgctacgcccccctgctgccc
gtcccggccgacgtcgcgaccaagccgaacatcaaccccggctggaccaagctcgtccag
gccgacaacctcgcccgcgagctgggcgtcaccggcggcctgtacgtcaaggacgactcc
ggcaaccccacgcactccttcaaggaccgcgtcgtcgcccaggccatcgaggccgcccgc
gccttcggcttcaccaccctgtcctgctcctccaccggcaacctcgccggtgccgtcggc
gccgccgccgcccgggccggcttccgctcctgcgtgttcatcccgcacgacctggagcag
ggcaaggtcgtcatggccgccgtctacggcggtgagctggtcggcatcgagggcaactac
gacgacgtgaaccgcttctgctccgagctgatcggcgaccctgccggcgagggctggggc
ttcgtcaacgtcaacctgcggccgtactacgccgagggttccaagaccctcgcctacgag
atctgcgagcagctcggctggcggctgcccgaccagatcgtcgtgccgatcgcctccggc
tcccagctgacgaagatcgacaaggggctcaaggagctgatcgagctgggtctggtcgag
gaccggccgtacaagatcttcggcgcgcaggccgagggctgctcgccggtctccacggcg
tacaaggccgggcacgacgtggtccgcccgcagaagccgaacaccatcgccaagtcgctg
gccatcggcaacccggccgacggcccctacgtcctcgacatcgcccgccgcaccggcggc
gccgtggaggacgtgaccgacgagcaggtcgtggacgcgatcaagctgctcgcccgtacc
gagggcatcttcgcggagacggcgggcggcgtgacggtcggcgtcaccaggaagctgatc
gagaacggcgtcctcgacccgtcgctcaccaccgtcgtcctgaacaccggcgacggcctg
aagaccctcgacgcggtggccggcaccggtctcaccgccaccatccgccccaacctggac
tccttccgagaggctggcctcgcatga

DBGET integrated database retrieval system