KEGG   Streptomyces coelicolor: SCO4384Help
Entry
SCO4384           CDS       T00085                                 

Gene name
SCD10.16
Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sco  Streptomyces coelicolor
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    SCO4384 (SCD10.16)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SCO4384 (SCD10.16)
   00650 Butanoate metabolism
    SCO4384 (SCD10.16)
  Lipid metabolism
   00071 Fatty acid degradation
    SCO4384 (SCD10.16)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCO4384 (SCD10.16)
   00310 Lysine degradation
    SCO4384 (SCD10.16)
   00360 Phenylalanine metabolism
    SCO4384 (SCD10.16)
   00380 Tryptophan metabolism
    SCO4384 (SCD10.16)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SCO4384 (SCD10.16)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SCO4384 (SCD10.16)
   00281 Geraniol degradation
    SCO4384 (SCD10.16)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SCO4384 (SCD10.16)
   00627 Aminobenzoate degradation
    SCO4384 (SCD10.16)
   00930 Caprolactam degradation
    SCO4384 (SCD10.16)
Enzymes [BR:sco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SCO4384 (SCD10.16)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
4801461..4802204
Genome map
AA seq 247 aa AA seqDB search
MTPPAHVDRTRARGVETLTLDSPHNRNALSAALVDGLAAALTAAGDDPGVRAVVLTHTGN
TFSAGADLRDPPDPDALVGLFRRIIELPKPVIARVAGHVRAGGLGLVAACDIAAASTEST
FAFTEVRIGVAPAVISLTLLPRADPRALARHYLTGERFDAAEAARAGLVTAAGDDVDAVL
EPVLDGVRRAAPQGLAETKRLLTARVLEAFDRDAADLTALSARLFASPQAREGMTAFLER
RDPEWVV
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaccccgcccgcccacgtcgaccgcacacgcgcgcggggcgtcgagaccctcaccctc
gactccccgcacaaccgcaacgcgctgtccgccgccctcgtcgacggcctggccgccgcc
ctcaccgcggcgggcgacgaccccggcgtccgtgccgtcgtgctcacccacaccggcaac
accttcagcgccggcgccgacctgcgcgacccgcccgacccggacgccctggtcggtctc
ttccggcggatcatcgagctgccgaaaccggtgatcgcccgcgtcgccgggcacgtccgc
gcgggcgggctcggcctggtcgccgcctgcgacatcgcggcggcgtccaccgagtcgacc
ttcgccttcaccgaggtccgcatcggcgtggcgcccgccgtcatctccctgaccctgctg
ccccgcgccgacccccgcgccctcgcccgccactacctcaccggcgagcgcttcgacgcc
gccgaggccgcccgcgccggcctggtcaccgcggcgggcgacgacgtggacgccgtactc
gaacccgtcctcgacggtgtgcgccgtgccgccccgcagggcctggccgagacgaaacgg
ctgctcacggctagggtgctggaggccttcgaccgggacgcggccgacctgaccgcgctc
tcggcccggctgttcgcctccccgcaggcccgcgaggggatgacggccttcctcgaacga
cgggatccggaatgggtggtgtga

DBGET integrated database retrieval system