KEGG   Streptomyces coelicolor: SCO4444Help
Entry
SCO4444           CDS       T00085                                 

Gene name
SCD6.22c
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
sco  Streptomyces coelicolor
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SCO4444 (SCD6.22c)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SCO4444 (SCD6.22c)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SCO4444 (SCD6.22c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(4865924..4866505)
Genome map
AA seq 193 aa AA seqDB search
MRARPRDPGKIQTAPPSILCMTSAPNTRNDDNLPLDVEIGALQGGAADLSQYAGRVVLVV
NVASKCGLTPQYAGLERLHERYAEQGFTVLGVPCNQFMGQEPGSADEIAEFCSATYGVTF
PMTGKAEVNGEGRHPLYDRLTGFADAEGHSGDIRWNFEKFLIGRDGKVAARFSPQTEPEA
AEVVAAVEERLAG
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtgccagaccccgcgaccccggcaagatccaaacggcaccccctagcatcctgtgc
atgacgagcgcaccgaacacgcggaacgacgacaaccttcccctcgacgtcgagatcggc
gccctccagggcggggccgcggacctctcgcagtacgccggccgggtcgtgctggtggtc
aacgtggcctccaagtgcgggctcaccccgcagtacgccggcctggagcgactgcacgag
cggtacgcggagcaggggttcaccgtgctgggcgtgccctgcaaccagttcatgggccag
gagccgggcagcgccgacgagatcgccgagttctgctcggcgacctacggggtcaccttc
ccgatgaccgggaaggccgaggtcaacggcgagggccggcatccgctgtacgaccggctg
accggcttcgcggacgccgagggccacagcggggacatccgctggaacttcgagaagttc
ctgatcgggcgggacggcaaggtcgccgcccgcttctcgccgcagaccgagccggaggcg
gccgaggtcgtggcggccgtcgaggaacgcctcgccggttga

DBGET integrated database retrieval system