KEGG   Streptomyces coelicolor: SCO4660Help
Entry
SCO4660           CDS       T00085                                 

Gene name
rspG, SCD40A.06
Definition
(RefSeq) 30S ribosomal protein S7
  KO
K02992  small subunit ribosomal protein S7
Organism
sco  Streptomyces coelicolor
Pathway
sco03010  Ribosome
Module
sco_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:sco00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    SCO4660 (rspG)
Ribosome [BR:sco03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    SCO4660 (rspG)
  Bacteria
    SCO4660 (rspG)
  Archaea
    SCO4660 (rspG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S7 Cas_DxTHG
Motif
Other DBs
NCBI-GeneID: 1100101
NCBI-ProteinID: NP_628820
Kitasato: SCO4660
UniProt: Q9L0K4
Position
5089320..5089790
Genome map
AA seq 156 aa AA seqDB search
MPRKGPAPKRPVIIDPVYGSPLVTSLINKVLLNGKRSTAERIVYGAMEGLREKTGNDPVI
TLKRALENIKPTLEVKSRRVGGATYQVPIEVKPGRANTLALRWLVGYSRARREKTMTERL
LNELLDASNGLGAAVKKREDTHKMAESNKAFAHYRW
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgtaagggccccgccccgaagcgcccggtcatcatcgacccggtctacggttct
cctctggtgacctccctgatcaacaaggtgctgctgaacggcaagcgctccaccgccgag
cgcatcgtctacggcgccatggagggtctgcgcgagaagaccggcaacgacccggtcatc
acgctcaagcgcgctctcgagaacatcaagccgaccctcgaggtcaagtcccgccgtgtc
ggtggcgcgacctaccaggtcccgatcgaggtcaagccgggccgtgcgaacacgctcgcc
ctgcgctggctggtcggttactcccgcgcccgtcgcgagaagaccatgaccgagcgtctg
ctcaacgagctcctcgacgcctccaacggcctgggtgccgctgtgaagaagcgcgaggac
acgcacaagatggccgagtccaacaaggccttcgcgcactaccgctggtag

DBGET integrated database retrieval system