KEGG   Streptomyces coelicolor: SCO4781Help
Entry
SCO4781           CDS       T00085                                 

Gene name
SCD63.13
Definition
cholesterol oxidase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
sco  Streptomyces coelicolor
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    SCO4781 (SCD63.13)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     SCO4781 (SCD63.13)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
5201210..5203018
Genome map
AA seq 602 aa AA seqDB search
MPQDAYDYDVLVVGSGFGGSVSALRLTEKGYRVGVLEAGRRFTRESLPKNSWDLKNYLWA
PKLGMFGIQRIHLLGNVMVLAGAGVGGGSLNYANTLYVPPKPFFDDPQWRGITDWHEELT
PYYDQARRMLGVRLNPTMTPSDVHLKAAAERMGCGDTFHMAPVGVFFGDGEDADGTAKAG
PGEQVPDPYFGGAGPDRKACNECGECMTGCRHGAKNTLNENYLYLAEKAGAVVHPMTTAV
SVTDDSRGGFAVATLPTDRKKRGKRGKQQAGRTFTARRVVLAAGTYGTQTLLHRMKAGGQ
LPRLSDVLGELTRTNSEALVGAQTDDRRYRGATGEPRADFTRGVAITSSIHPDANTHIEP
VRYGKGSNSMGGLSILQVPYAGQTASGASRVLGFLGHAAKHPLLVLRSLSNRKWSERTII
GLVMQSLDNSLTTHLKPAGVGKGLLTARQGHGSPNPKQIKAATDGASALAAEINGFAGSN
VGELMGTPLTAHFLGGCPIGASRETGVIDPYHRLYGHPGISVVDGAAVSANLGVNPSLTI
TAQAERAMSYWPNKGESDPRPAQGAGYERVAAVAPRSPAVPERAFGALRLPFVEMPTVPP
KK
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
gtgccccaggatgcatacgactacgacgtcctcgtcgtgggatccggcttcggcggctcc
gtctccgccctccgcctcaccgagaagggctaccgcgtcggcgtcctggaggccggccgc
cgtttcacccgggagtcgctgcccaagaactcctgggacctgaagaactacctctgggcg
ccgaagctcggcatgttcggcatccagcgcatccacctgctcgggaatgtcatggtcctg
gcaggcgccggggtcggcggcggctcgctcaactacgccaacaccctgtacgtgccgccg
aagcccttcttcgacgacccccagtggcgcggcatcaccgactggcacgaggaactcacg
ccgtactacgaccaggcccggcgcatgctcggggtccggctcaacccgacgatgaccccc
tccgacgtgcacctgaaggccgccgccgagcggatgggctgcggcgacaccttccacatg
gccccggtcggcgtcttcttcggcgacggcgaggacgccgacggcacggcgaaggccggg
ccgggcgagcaggtgcccgatccgtacttcggcggcgcgggccccgaccgcaaggcctgc
aacgagtgcggcgagtgcatgaccggctgccggcacggtgcgaagaacaccctcaacgag
aactacctctacctcgccgagaaggccggagccgtcgtccacccgatgaccacggccgtc
tccgtcacggacgactcgcgcggcggcttcgcggtcgccacgctccccaccgaccgcaag
aagcgcgggaagcgcgggaaacagcaggcgggccgcaccttcaccgcccgccgcgtcgtc
ctggccgccggcacctacggcacccagaccctgctgcaccgcatgaaggcgggcggccag
ctcccccgcctgtcggacgtgctcggcgagctgacccgcaccaactccgaggcactggtc
ggcgcccagaccgacgaccggcgctaccgcggcgccaccggggagccccgggccgacttc
acgcgcggcgtcgccatcacgtcctccatccacccggacgccaacacccacatcgagccg
gtccgttacggcaagggctccaactcgatgggcggcctgtccatcctccaggtcccctac
gccgggcagaccgcctcgggcgcctcgcgcgtcctgggcttcctcggccacgcggccaag
cacccgctgctggtcctgcgttcgctctccaaccgcaagtggtcggagcggaccatcatc
ggcctggtcatgcagtccctggacaactccctgaccacgcacctcaaaccggccggcgtc
ggcaagggcctgctcaccgcgcgccagggccacgggtcgcccaaccccaagcagatcaag
gccgccaccgacggtgcctccgcactcgccgccgagatcaacggcttcgccggctccaac
gtcggcgagctgatgggcaccccgctcaccgcccacttcctcggcggctgcccgataggc
gcctcccgggagaccggcgtcatagacccctaccaccgcctctacggccaccccggcatc
tcggtcgtcgacggcgccgccgtctcggccaacctcggcgtcaatccttccctgaccatc
accgcgcaggccgagcgggcgatgtcgtactggcccaacaagggcgagagcgacccgcgc
cccgcgcagggcgccgggtacgaacgggtggccgccgtcgcgccccggtcgccggccgtc
ccggagcgggccttcggcgcgctgcgcctgccgttcgtggagatgccgacggtgccgccg
aagaagtag

DBGET integrated database retrieval system