KEGG   Streptomyces coelicolor: SCO4857Help
Entry
SCO4857           CDS       T00085                                 

Gene name
SC5G8.25c
Definition
succinate dehydrogenase membrane subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
sco  Streptomyces coelicolor
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO4857 (SC5G8.25c)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCO4857 (SC5G8.25c)
   00650 Butanoate metabolism
    SCO4857 (SC5G8.25c)
  Energy metabolism
   00190 Oxidative phosphorylation
    SCO4857 (SC5G8.25c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(5286986..5287468)
Genome map
AA seq 160 aa AA seqDB search
MSTTESPASGIGPIEGASLYSADNPAPLIEAPRARTKKSPKSTRGNFEMAAWLFMRLSGV
VLVVLVLGHLLIQLVLDGGVSKIGFAFVAGRWASPFWQVWDLLMLWLAMLHGANGLRTVI
NDYAERPNTRLWLKGLLYTATVFTILLGTLVIFTFDPNIR
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgtccacgactgaatcccccgcttccgggatcggccccatcgagggcgcctccctctac
tcggccgacaacccggcgccgctcatcgaggcgccccgcgcccgcacgaagaagtccccg
aagtccacccggggcaacttcgagatggccgcctggctgttcatgcgcctgtccggcgtc
gtgctggtcgtgctcgtcctcggccacctgctcatccagctggtgctggacggcggtgtc
tccaagatcggcttcgccttcgtggcgggccgctgggcctcgccgttctggcaggtctgg
gacctcctgatgctctggctcgcgatgctgcacggcgcgaacggcctgcgcacggtcatc
aacgactacgcggagcgccccaacacccggctgtggctcaagggcctgctctacaccgcc
acggtgttcaccatcctgctgggcacgctggtgatcttcaccttcgacccgaacatccgc
tag

DBGET integrated database retrieval system