KEGG   Streptomyces coelicolor: SCO4860Help
Entry
SCO4860           CDS       T00085                                 

Gene name
SC5G8.28, SCK20.01
Definition
hydrolase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
sco  Streptomyces coelicolor
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SCO4860 (SC5G8.28)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SCO4860 (SC5G8.28)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SCO4860 (SC5G8.28)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
5288869..5290443
Genome map
AA seq 524 aa AA seqDB search
MIAGAVVAALGVGAGLWATDGDGGGDGDREGSAARSSTGEAAAPSPSRSYPLSKEPRTIP
AVREHTAARGPGWQPEKGNRVVVADSGLADEGKQIAGDLGMTYAGEKDDERAGDLLLDVK
AAKGANPESYTMTVRDGRVTVTGPAEAGVYYGTRTLKQAVDGGGTAPEGVVKDEPAKPKR
GFSLDIARKHYSADWIKDRIRELGDLKFNELGLHFSDDQAFRIESDSHPEIVSDEHLTKA
EMKEIIDLAASRHITVVPEIDSPGHLGAVIAAHPDLQLRNAQGTATRGAIDISKPEAAKI
VDDLLNEYADLFPGSQFHLGADEYQALVVPNPEASYPTLAAAARKAYGSGGTVADLTTGW
LNGRAKTVMAHDRTPRAWNDGFFKDTSVEPLKDIKVAYWTGKEIGARPPAEYLGEGRQVL
NYNDEFLYYVLGQPQTFVYPTGERIYEQWTPRVLRGTTAVDAKYDDQILGGSFAVWGDFP
NAQTQAQVAEGIRLPLAATVQKLWDPGKPELSWTDFAALANRLD
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgccggcgcggtggtcgccgccctcggcgtgggagccggcctgtgggccaccgac
ggcgacggcggcggtgacggcgaccgggagggctcggcggcccggtcctccaccggcgag
gcggccgcccccagcccgagccggtcctatccgctgtccaaggagccgcgcaccatcccc
gccgtgcgtgagcacaccgccgcgcgcggccccggctggcagcccgagaaggggaaccgg
gtcgtcgtggccgactccggactcgccgacgagggcaagcagatcgccggggacctcggg
atgacgtacgcgggggagaaggacgacgagcgcgccggggacctgctgctcgacgtgaag
gccgccaagggtgcgaacccggagtcgtacaccatgaccgtgcgggacggccgggtcacc
gtcaccgggcccgccgaggccggcgtctactacggcacccgcaccctgaagcaggcggtg
gacggcggcggcaccgcgccggagggcgtcgtgaaggacgagcccgccaaaccgaagcgc
ggcttctcgctcgacatcgcccgcaagcactacagcgccgactggatcaaggaccggata
cgcgagctgggcgacctcaagttcaacgagctgggcctgcacttctccgacgaccaggcc
ttccgcatcgagtccgactcgcaccccgagatcgtctcggacgagcacctgaccaaggcc
gagatgaaggagatcatcgatctcgccgcctcgcgccacatcaccgtcgtccccgagatc
gactcgccgggccacctcggcgcggtgatcgccgcccaccccgacctccagctgcgcaac
gcgcagggcacggccacccgcggcgccatcgacatctccaagccggaggccgcgaagatc
gtcgacgacctgctgaacgagtacgccgacctcttccccggctcccagttccacctgggc
gccgacgagtaccaggcgctcgtggtgccgaacccggaggcgtcctacccgacgctggcc
gccgcggcccgcaaggcctacggctccggcggcaccgtcgccgacctcaccaccggatgg
ctcaacggccgcgccaagacggtcatggcccacgaccgcaccccgcgcgcctggaacgac
ggcttcttcaaggacacgtccgtcgagccgctcaaggacatcaaggtcgcctactggacc
ggcaaggagatcggcgcccgcccgccggccgagtacctgggcgagggccgccaggtcctc
aactacaacgacgagttcctctactacgtgctcggccagccgcagaccttcgtctatccg
accggcgagcgcatctacgagcagtggaccccgcgcgtcctgcgcggcaccacggccgtc
gacgccaagtacgacgaccagatactcggcggcagcttcgccgtctggggcgacttcccg
aacgcccagacccaggctcaggtcgccgagggcatcaggctgccgctggccgcgacggtc
cagaagctgtgggaccccggcaaacccgagctgtcctggacggacttcgcggcgctggcg
aaccggctcgactga

DBGET integrated database retrieval system