KEGG   Streptomyces coelicolor: SCO4860Help
Entry
SCO4860           CDS       T00085                                 

Gene name
SC5G8.28, SCK20.01
Definition
hydrolase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
sco  Streptomyces coelicolor
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sco00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:sco00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
5288869..5290443
Genome map
AA seq 524 aa AA seqDB search
MIAGAVVAALGVGAGLWATDGDGGGDGDREGSAARSSTGEAAAPSPSRSYPLSKEPRTIP
AVREHTAARGPGWQPEKGNRVVVADSGLADEGKQIAGDLGMTYAGEKDDERAGDLLLDVK
AAKGANPESYTMTVRDGRVTVTGPAEAGVYYGTRTLKQAVDGGGTAPEGVVKDEPAKPKR
GFSLDIARKHYSADWIKDRIRELGDLKFNELGLHFSDDQAFRIESDSHPEIVSDEHLTKA
EMKEIIDLAASRHITVVPEIDSPGHLGAVIAAHPDLQLRNAQGTATRGAIDISKPEAAKI
VDDLLNEYADLFPGSQFHLGADEYQALVVPNPEASYPTLAAAARKAYGSGGTVADLTTGW
LNGRAKTVMAHDRTPRAWNDGFFKDTSVEPLKDIKVAYWTGKEIGARPPAEYLGEGRQVL
NYNDEFLYYVLGQPQTFVYPTGERIYEQWTPRVLRGTTAVDAKYDDQILGGSFAVWGDFP
NAQTQAQVAEGIRLPLAATVQKLWDPGKPELSWTDFAALANRLD
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgccggcgcggtggtcgccgccctcggcgtgggagccggcctgtgggccaccgac
ggcgacggcggcggtgacggcgaccgggagggctcggcggcccggtcctccaccggcgag
gcggccgcccccagcccgagccggtcctatccgctgtccaaggagccgcgcaccatcccc
gccgtgcgtgagcacaccgccgcgcgcggccccggctggcagcccgagaaggggaaccgg
gtcgtcgtggccgactccggactcgccgacgagggcaagcagatcgccggggacctcggg
atgacgtacgcgggggagaaggacgacgagcgcgccggggacctgctgctcgacgtgaag
gccgccaagggtgcgaacccggagtcgtacaccatgaccgtgcgggacggccgggtcacc
gtcaccgggcccgccgaggccggcgtctactacggcacccgcaccctgaagcaggcggtg
gacggcggcggcaccgcgccggagggcgtcgtgaaggacgagcccgccaaaccgaagcgc
ggcttctcgctcgacatcgcccgcaagcactacagcgccgactggatcaaggaccggata
cgcgagctgggcgacctcaagttcaacgagctgggcctgcacttctccgacgaccaggcc
ttccgcatcgagtccgactcgcaccccgagatcgtctcggacgagcacctgaccaaggcc
gagatgaaggagatcatcgatctcgccgcctcgcgccacatcaccgtcgtccccgagatc
gactcgccgggccacctcggcgcggtgatcgccgcccaccccgacctccagctgcgcaac
gcgcagggcacggccacccgcggcgccatcgacatctccaagccggaggccgcgaagatc
gtcgacgacctgctgaacgagtacgccgacctcttccccggctcccagttccacctgggc
gccgacgagtaccaggcgctcgtggtgccgaacccggaggcgtcctacccgacgctggcc
gccgcggcccgcaaggcctacggctccggcggcaccgtcgccgacctcaccaccggatgg
ctcaacggccgcgccaagacggtcatggcccacgaccgcaccccgcgcgcctggaacgac
ggcttcttcaaggacacgtccgtcgagccgctcaaggacatcaaggtcgcctactggacc
ggcaaggagatcggcgcccgcccgccggccgagtacctgggcgagggccgccaggtcctc
aactacaacgacgagttcctctactacgtgctcggccagccgcagaccttcgtctatccg
accggcgagcgcatctacgagcagtggaccccgcgcgtcctgcgcggcaccacggccgtc
gacgccaagtacgacgaccagatactcggcggcagcttcgccgtctggggcgacttcccg
aacgcccagacccaggctcaggtcgccgagggcatcaggctgccgctggccgcgacggtc
cagaagctgtgggaccccggcaaacccgagctgtcctggacggacttcgcggcgctggcg
aaccggctcgactga

DBGET integrated database retrieval system