KEGG   Streptomyces coelicolor: SCO5355Help
Entry
SCO5355           CDS       T00085                                 

Gene name
SCBAC5H2.24, thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sco  Streptomyces coelicolor
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCO5355 (SCBAC5H2.24)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO5355 (SCBAC5H2.24)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SCO5355 (SCBAC5H2.24)
Enzymes [BR:sco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SCO5355 (SCBAC5H2.24)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
5823511..5824569
Genome map
AA seq 352 aa AA seqDB search
MTHQWRGIIEEYRDRLPVSDSTPVVTLREGGTPLVPAQVLSERTGCEVHLKVEGANPTGS
FKDRGMTMAISKAKEEGAQAVICASTGNTSASAAAYGVRAGMVSAVLVPQGKIALGKMGQ
ALVHGAKILQVDGNFDDCLTLARALSDNYPVALVNSVNPVRIEGQKTAAFEIVDMLGDAP
DIHVLPVGNAGNITAYWKGYQEYAADGVSTKKPRMWGFQASGSAPIVRGEVVKDPSTIAT
AIRIGNPASWDFALAARDESGGAIDEVTDREILRAYRLLASQEGVFVEPASAASVAGLLK
AAEQGKVDPGQRIVCTVTGNGLKDPDWAVAGAPQPVTVPVDAATAAERLGLV
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgacccaccagtggcgcggaatcatcgaggagtaccgggaccggctgcccgtctccgac
agcacgcccgtcgtgacgctccgtgagggcggcaccccgctcgtgcccgcgcaggtgctc
tccgagcgcacgggctgcgaggtccacctcaaggtcgagggggcgaacccgaccgggtcc
ttcaaggaccgtggcatgaccatggccatcagcaaggccaaggaggagggcgcgcaggcc
gtcatctgcgcgtccaccgggaacacgtccgcgagtgccgccgcgtacggcgtgcgcgcg
ggcatggtctccgccgtgctcgtgccgcagggcaagatcgcgctcggcaagatgggccag
gccctcgtgcacggcgcgaagatcctccaggtcgacggcaacttcgacgactgcctcacg
ctggcccgtgcgctcagcgacaactacccggtggcactggtcaattcggtcaacccggtg
cgtatcgaggggcagaagacggccgccttcgagatcgtggacatgctcggcgacgcgccc
gacatacatgtccttcccgtgggcaacgcgggcaacatcaccgcgtactggaaggggtac
caggagtacgccgccgacggggtcagcaccaagaagccccgcatgtgggggttccaggcc
tccggctccgccccgatcgtgcgcggcgaggtcgtcaaggacccgtcgaccatcgccacc
gccatccggatcggcaaccccgcctcgtgggacttcgcgctcgccgcgcgcgacgagtcg
ggcggcgccatcgacgaggtgacggaccgtgagatcctgcgcgcctaccggctgttggcc
tcgcaggagggcgtcttcgtggagcccgcctccgccgcctccgtggccggtctgctgaag
gccgccgagcagggcaaggtcgacccggggcagcgcatcgtgtgcaccgtcaccggcaac
gggctgaaggacccggactgggccgtcgccggcgcgccgcagccggtcaccgtcccggtc
gacgcggcgacggcggccgagcggctcgggctggtctga

DBGET integrated database retrieval system