KEGG   Streptomyces coelicolor: SCO5426Help
Entry
SCO5426           CDS       T00085                                 

Gene name
pfkA2, SC6A11.02
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sco  Streptomyces coelicolor
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO5426 (pfkA2)
   01230 Biosynthesis of amino acids
    SCO5426 (pfkA2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO5426 (pfkA2)
   00030 Pentose phosphate pathway
    SCO5426 (pfkA2)
   00051 Fructose and mannose metabolism
    SCO5426 (pfkA2)
   00052 Galactose metabolism
    SCO5426 (pfkA2)
  Energy metabolism
   00680 Methane metabolism
    SCO5426 (pfkA2)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SCO5426 (pfkA2)
Protein phosphatases and associated proteins [BR:sco01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SCO5426 (pfkA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
5897944..5898969
Genome map
AA seq 341 aa AA seqDB search
MRIGVLTAGGDCPGLNAVIRSVVHRAVDNYGDEVIGFEDGYAGLLDGRYRALDLNAVSGI
LARGGTILGSSRLERDRLREACENAGDMIQNFGIDALIPIGGEGTLTAARMLSDAGLPVV
GVPKTIDNDISSTDRTFGFDTAVGVATEAMDRLKTTAESHQRVMVVEVMGRHAGWIALES
GMAAGAHGICLPERPFDPADLVKMVEERFSRGKKFAVVCVAEGAHPAEGSMDYGKGAIDK
FGHERFQGIGTALAFELERRLGKEAKPVILGHVQRGGVPTAYDRVLATRFGWHAVEAAHR
GDFGRMTALRGTDVVMVPLAEAVTELKTVPKDRMDEAESVF
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcggagttctcaccgcaggcggcgactgccccggcctgaacgcagtgatccgg
tcggtcgtgcaccgagcggtggacaactacggcgacgaggtcatcggcttcgaggacggc
tacgcggggctgctggacggccgttaccgcgccctggacctcaacgcggtcagcggcatc
ctcgcccgcggcggcaccatcctcggctcctcccgactggagcgcgaccggctccgcgag
gcctgcgagaacgcgggcgacatgatccagaacttcggcatcgacgccctgatcccgatc
ggcggcgagggcaccctcacggccgcccggatgctgtccgacgccgggctcccggtggtc
ggcgtgccgaagaccatcgacaacgacatctcctccaccgaccgcaccttcggcttcgac
acggcggtcggtgtcgcgaccgaggccatggaccgcctcaagaccaccgccgagtcccac
cagcgcgtgatggtcgtcgaggtcatgggccggcacgccggctggatcgccctggagtcc
ggcatggccgccggtgcccacggcatctgcctgcccgagcgccccttcgaccccgccgac
ctggtcaagatggtcgaggagcgcttctcccgcggcaagaagttcgccgtcgtctgcgtc
gccgagggcgcccaccccgccgagggctccatggactacggcaagggcgcgatcgacaag
ttcggccacgagcgcttccagggcatcggcaccgcgctcgccttcgagctggagcgccgg
ctcggcaaggaggccaagccggtcatcctcggccacgtccagcgcggcggcgtccccacc
gcgtacgaccgcgtcctcgccacccgcttcggctggcacgcggtggaggccgcgcaccgg
ggcgacttcggccggatgacggcgctgcgcggcaccgacgtggtgatggtgccgctggcg
gaggcggtcaccgagctgaagacggtcccgaaggaccggatggacgaggcggagtccgtc
ttctag

DBGET integrated database retrieval system