KEGG   Streptomyces coelicolor: SCO5689Help
Entry
SCO5689           CDS       T00085                                 

Gene name
SC5H4.13
Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
sco  Streptomyces coelicolor
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SCO5689 (SC5H4.13)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SCO5689 (SC5H4.13)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
6195389..6197359
Genome map
AA seq 656 aa AA seqDB search
MPGLSDATRRRILFGGDYNPEQWPEETWPEDVRLMKTAGVNSVTLGVFSWSKLEPRPGVH
DFGWLDRLMDLLHEGGIGVVLATPTASPPPWLGHLHPDTLPRDADGRTEWWGGRQHFSHS
STAYRRHAAAITEALAARYGGHPALTMWHINNEYCTYDHGDEAATRFRRWLRDRYGTLDA
LNTAWGTAFWSQGYGDWAEVVPPRRAHYLRNPTQVLDFRRFTSDMLLECCTAERDIVRRH
TPHIPVTTNFMPLWSGQDAWRWAEEEDVVSVDLYPDPRDPFGAQEGALVQDMTRSQARGP
WMLMEQAAGAVNWRGVNHPKPRGLNRLWSLQAVARGADAVCYFQWRQSRQGAEKFHSGMV
SHAGERGRTYQEVKQLGADLARIAPHVTGGAVAADVAVLHDWHSWWAGDQEARPSREVDY
PDVLRAWHRALWQAGLTTDFARPDHDLTGYRLVVVPQLYLLTDAAVDNLVAHVRGGATLV
CGFLTGVADQDDRIRPGAMDVRLRELFGIRTLHEWWPLRPGERAECEGGLRGTLWSEELE
PDGTADETIAYRGGELDGLPAVLRKGRAWYLSTLPEPDRLRALLARAAADAGVRPVLDGL
PDGVEAVRRGDLLFLLNHGREPVTVDLPGTHHDLLTQTTATDRITLGRYGAAVLKP
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgccgggcctgtccgacgccacccgccggcgcatcctcttcggcggcgactacaacccc
gagcagtggcccgaggagacctggcccgaggacgtacgcctgatgaagaccgccggcgtc
aactccgtcaccctcggcgtcttctcctggtcgaagctcgaaccacgccccggcgtccac
gacttcggctggctggaccggctcatggacctgctgcacgaaggcggcatcggcgtcgtc
ctcgccacccccaccgcctcgcccccgccctggctggggcacctgcaccccgacaccctg
ccgcgcgacgccgacggccgcaccgagtggtggggcggccgacagcacttctcgcactcc
agcaccgcctaccgccgacacgccgccgccatcaccgaggcactggccgcgcggtacggg
ggccaccccgcgctcaccatgtggcacatcaacaacgagtactgcacctacgaccacggc
gacgaggccgccacccgcttccgccgctggctccgggaccgctacggcaccctcgacgcc
ctcaacaccgcctggggcaccgccttctggagccagggctacggcgactgggccgaggtc
gtcccgccccgccgcgcccactacctgaggaaccccacgcaggtcctggacttccggcgc
ttcacctccgacatgctcctggagtgctgcaccgccgagcgcgacatcgtccgccgccac
accccgcacatcccggtcaccaccaacttcatgccgctgtggtcgggccaggacgcctgg
cgctgggccgaggaggaggacgtcgtctccgtcgacctctaccccgacccgcgcgacccg
ttcggcgcccaggagggtgccctggtccaggacatgacccgctcccaggcccgcggcccg
tggatgctcatggagcaggcggccggtgccgtcaactggcgcggcgtgaaccaccccaag
ccgcgcggcctcaaccgcctctggtcgctccaggcggtggcccgcggcgcggacgccgtc
tgctacttccagtggcgccagtcgcggcagggtgccgagaagttccactccgggatggtc
tcccacgcgggggagcgggggcgcacctaccaggaggtcaagcagctcggcgcggacctg
gcccggatcgccccgcacgtcaccggcggcgcggtcgccgccgacgtggccgtcctgcac
gactggcactcctggtgggccggcgaccaggaggcccggccctcccgagaggtcgactac
cccgacgtcctgcgcgcctggcaccgcgcgctctggcaggccggtctcaccaccgacttc
gcccgccccgaccacgacctgaccggctaccggctcgtggtcgtcccgcagctctacctc
ctcaccgacgcggccgtcgacaacctcgtcgcccacgtgcgtggcggcgccaccctcgtc
tgcggcttcctgaccggggtcgccgaccaggacgaccggatacggcccggtgccatggac
gtccggctgcgcgagctgttcggcatccgcaccctgcacgagtggtggccgctgcggccg
ggcgagagagccgagtgcgagggcggcctgcgcggcaccctgtggtccgaggaactcgag
cccgacggcaccgccgacgagacgatcgcctaccggggcggggaactcgacggactgccg
gccgtcctgcgcaagggccgcgcctggtacctctccacgctccccgagccggaccggctg
cgcgcgctgctggcccgcgccgccgccgacgcgggcgtccggccggtgctcgacgggctc
ccggacggcgtcgaggcggtccggcgcggtgacctgctgttcctgctcaaccacggccgc
gaaccggtcaccgtcgacctcccgggcacccaccacgacctgctgacgcagacgacggcc
accgaccggatcaccctcggccgctacggcgcggcggtgctgaagccatga

DBGET integrated database retrieval system