KEGG   Streptomyces coelicolor: SCO5998Help
Entry
SCO5998           CDS       T00085                                 

Gene name
murA2, SCBAC1C11.01c, StBAC16H6.33c
Definition
UDP-N-acetylglucosamine transferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
sco  Streptomyces coelicolor
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SCO5998 (murA2)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SCO5998 (murA2)
Enzymes [BR:sco01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     SCO5998 (murA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(6573186..6574715)
Genome map
AA seq 509 aa AA seqDB search
MADDYLVRIGRLIRDARQHRGWTQSQLAEALNTSQSAVNRIERGNQNISLEMIARIGEAL
DSEIVSLGYAGPMHLRVVGGRRLSGAIDVKTSKNACVALLCASLLNKGRTVLRRVARIEE
VYRLLEVLNSIGVRTRWINDGTDLEIVPPAELDMEAIDAEAAVRTRSIIMFLGPLLHRME
RFRLPYAGGCDLGTRTIEPHMIALRRFGLDVAATEGHYHAVVDRQVRPDRPIVLTERGDT
VTENALLAAARHDGVTVIRNASSNYMVQDLCFFLEALGVRVEGIGTTTLTVHGMPVIDAD
VDYSPSEDPVEAMSLLAAAVVTESELTVRRVPIEFLEIELAVLEEMGLDHDRTPEYFADN
GRTRLVDLTVRPSKLEAPIDKIHPMPFPGLNIDNVPFFAAIAASAQGQTLIHDWVYDNRA
IYLTDLNRLGGRLQLLDPHRVLVEGPTRWRAAEMMCPPALRPAVVVLLAMMAAEGTSVLR
NVYVINRGYEDLAERLNSIGAQIEIFRDI
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgactacctcgtacgcatcggcaggctcatccgtgacgcccggcagcaccgc
ggctggacgcagtcacagctcgcggaggcgctcaacaccagtcagagcgccgtcaaccgc
atcgagcgcggcaaccagaacatcagccttgagatgatcgcccggatcggcgaagcgctg
gacagcgaaatcgtctccctgggctacgcgggtccgatgcacctgcgcgtggtcggcggc
cgtcgcctgtccggcgccatcgacgtcaagaccagcaagaacgcctgcgtggccctgctg
tgcgcctcgctgctcaacaaggggcgcacggtactgcgccgggtcgcccgcatcgaggag
gtctaccgcctcctggaggtgctcaactccatcggcgtgcgcacccgctggatcaacgac
ggcaccgacctggagatcgtgccgccggccgagctggacatggaggccatcgacgccgag
gccgccgtccgcacccgctccatcatcatgttcctcggcccgctgctgcaccgcatggag
cgcttccgcctgccctacgccggcggctgcgacctcggcacccgcaccatcgagccgcac
atgatcgcgctgcgccggttcggcctggacgtcgccgcgaccgagggccactaccacgcg
gtggtcgaccgccaggtgcgcccggaccgccccatcgtcctgaccgagcgcggcgacacg
gtgacggagaacgccctcctggccgccgcccgccacgacggcgtcaccgtcatccgcaac
gcctcctccaactacatggtccaggacctctgcttcttcctggaggccctgggcgtccgc
gtcgaaggcatcggcaccaccaccctcaccgtccacggcatgccggtcatcgacgccgac
gtggactactccccctccgaggacccggtcgaggcgatgagcctgctggccgccgccgtg
gtcacggagtcggagctgacggtgcgccgggtcccgatcgagttcctggagatcgagctg
gcggtcctggaggagatgggcctcgaccacgaccgcaccccggagtacttcgccgacaac
ggccgtacccgcctggtggacctgaccgtgcgcccctccaagctggaggcgccgatcgac
aagatccacccgatgcccttcccgggcctgaacatcgacaacgtccccttcttcgcggcc
atcgcggcctcggcgcagggccagaccctcatccacgactgggtctacgacaaccgcgcc
atctacctcaccgacctgaaccgcctcggcggccgcctccagctcctggacccgcaccgc
gtcctggtcgagggccccacccgctggcgcgccgccgagatgatgtgcccgccggccctg
cgccccgcggtcgtcgtcctgctggcgatgatggccgccgagggcacgtcggtactgcgc
aacgtctacgtcatcaaccgcggctacgaggacctcgcggagcggctgaactcgatcggg
gcgcagatcgagatcttccgggacatctga

DBGET integrated database retrieval system