KEGG   Streptomyces coelicolor: SCO6195Help
Entry
SCO6195           CDS       T00085                                 

Gene name
SC2G5.16
Definition
acetyl-coenzyme A synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sco  Streptomyces coelicolor
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:sco01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sco00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sco00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:sco00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:sco00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
6804196..6805872
Genome map
AA seq 558 aa AA seqDB search
MTTATELFRTARDFLLEHREDYTAAYEGFRWPRPANFNWALDWFDVVAEGNGRTALHIVE
EDGREVRVSFAEMSARSNRVANRLREWGVGPEDRILVMLGNQAELWETALAAMKLRAVVI
PATTLLGPADLRDRVDRGRVGHVIARAEDTGKFDDVPGHYTRVAVGGATPAAGWRAYEDV
YGASDTFTPDGPTAADDPLMLYFTSGTTARPKLVEHTHVSYPVGHLATMYWIGLKPGDVH
LNISSPGWAKHAWSNLFAPWNAEATVFLYNYTRFDATRLMAEMDRAGVTTFCAPPTVWRM
LIQADLTRLATPPREVVAAGEPLNPEVIEQVRRLWGRTIRDGFGQTETAVQVSNSPGQVL
KTGSMGRPSPGYRVELLDPVTGAPGAAEGEIALDLSDHPVGLMTGYHGDPDRTAEAMAGG
YYRTGDIGARDEDGYLTYVGRADDVFKASDYKISPFELESALLEHEAVAEAAVVPAPDAL
RLAVPKAYIVLAAGWEPGPDTAKVLFEHSRDTLAAYKRVRRLEFGELPKTVSGKIRRIEL
REATAAGSANEYREEDFR
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgacgacggccacggagctgttccgcaccgcacgggacttcctgctggaacaccgcgag
gactacaccgccgcctacgaggggttccggtggccccgccccgcgaacttcaactgggcg
ctggactggttcgacgtcgtcgccgagggcaacgggcgcaccgccctgcacatcgtcgag
gaggacggccgcgaggtccgggtctccttcgccgagatgtccgcccgctccaaccgggtc
gcgaaccgcctgcgcgaatggggcgtcggtccggaggaccgcatcctcgtgatgctcggc
aaccaggccgagctgtgggagaccgcgctggccgcgatgaaactgcgcgcggtcgtcatc
ccggccaccaccctgctcggccccgccgacctgcgcgaccgcgtcgaccgcggccgggtc
gggcacgtgatcgcgcgcgccgaggacaccggcaagttcgacgacgtgcccggccactac
acgcgcgtcgccgtgggcggcgcaacgccggccgccggctggcgggcctacgaggacgtg
tacggcgcctccgacaccttcaccccggacggcccgaccgccgccgacgacccgctgatg
ctgtacttcacctccggcaccaccgcccgccccaaactggtcgagcacacccacgtgtcg
taccccgtcggccacctggcgaccatgtactggatcgggctcaagcccggcgacgtgcac
ctcaacatctcctcgcccggctgggccaagcacgcctggtcgaacctgttcgcgccgtgg
aacgccgaggccaccgtcttcctgtacaactacacgcggttcgacgcgacccgcctgatg
gccgagatggaccgggccggggtgaccaccttctgcgccccgcccaccgtgtggcgcatg
ctcatccaggccgacctcacccggctcgccaccccgccgcgcgaggtcgtcgccgccggt
gagccgctcaaccccgaggtgatcgaacaggtccgccgcctgtgggggaggaccatccgg
gacggcttcggccagaccgagaccgccgtccaggtctccaacagccccggccaggtgctg
aagaccggctcgatgggccgccccagccccggctaccgcgtcgagctgctcgatccggtg
accggcgcgcccggcgccgccgagggcgagatcgccctggacctgtccgaccaccccgtg
ggcctgatgaccggctaccatggcgaccccgaccgcaccgccgaggcgatggccggcggc
tactaccgcaccggcgacatcggcgcccgcgacgaggacggctacctcacctacgtgggc
cgggccgacgacgtgttcaaggcctccgactacaagatcagccccttcgagctggagagc
gcgctgctggagcacgaggcggtcgccgaggccgcggtcgtgcccgccccggacgcactg
cgcctcgcggtgccgaaggcgtacatcgtgctcgcggcgggctgggagcccggaccggac
accgcgaaggtgctcttcgagcactcccgcgacacgctcgccgcctacaagcgggtgcgc
cgcctggagttcggcgagctgcccaagaccgtctcgggcaagatccgccgcatcgaactg
cgggaggccacggcggccggttccgcgaacgagtaccgcgaggaggacttccggtga

DBGET integrated database retrieval system