KEGG   Streptomyces coelicolor: SCO6211Help
Entry
SCO6211           CDS       T00085                                 

Gene name
SC2G5.32, SC9G1.01
Definition
uricase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
sco  Streptomyces coelicolor
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
Purine degradation, xanthine => urea
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SCO6211 (SC2G5.32)
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    SCO6211 (SC2G5.32)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     SCO6211 (SC2G5.32)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
6824153..6825088
Genome map
AA seq 311 aa AA seqDB search
MTRFVLGQNQYGKAENRVVKITRDGDTHHIKDLNVSVALSGDMEEVHRSGSNANVLPTDT
TKNTVFAFAKEHGIESAEDLGVKLARHFVDNNEPIHRARIRIEEFGWERIETSKGGARFV
GAEEIAHSFVRTGQETRVAEITYDGHGIQVLSGFKDLTVLNSTNSEFFGYLKDKYTTLKE
DYDRILATTVSTWWRHNWDGVDSHAPDWDRSYHGVRKHALQAFAETYSYSLQQTLFEMGV
RVLNSRDEVDEIRFSMPNKHHFRSDLSPFGIDNEAKDGAVYYAADRPYGLIEATILRDGA
EQLIPVDMTNL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtttcgtcctgggacagaaccagtacggcaaggcagagaaccgcgtcgtcaag
atcacgcgtgacggcgacacgcaccacatcaaggacctgaacgtctccgtcgccctgtcc
ggcgacatggaggaggtccaccgcagcggttccaacgccaacgtcctgccgaccgacacc
accaagaacacggtgttcgccttcgccaaggagcacggcatcgagagcgccgaggacctc
ggcgtcaagctcgcccgtcacttcgtggacaacaacgagccgatccaccgggcccgcatc
cgcatcgaggagttcggctgggagcggatcgagacgtcgaagggcggcgcccgcttcgtc
ggcgcggaggagatcgcccactccttcgtccgcaccggccaggagacccgcgtcgccgag
atcacctacgacggccacggcatccaggtgctctccggcttcaaggacctgaccgtcctg
aactcgaccaactccgagttcttcggctacctgaaggacaagtacacgaccctcaaggag
gactacgaccggatcctcgccaccaccgtctccacctggtggcggcacaactgggacggc
gtcgactcgcacgccccggactgggaccgctcgtaccacggagtgcgcaagcacgcgctc
caggcgttcgccgagacctactcgtactcgctccagcagaccctcttcgagatgggcgtg
cgggtgctcaactcccgcgacgaggtcgacgagatccgcttctcgatgcccaacaagcac
cacttccgctcggacctgtcgcccttcgggatcgacaacgaggccaaggacggggccgtg
tactacgccgccgaccgcccgtacggcctgatcgaggccaccatcctgcgcgacggcgcc
gagcaactcatcccggtcgacatgaccaacctctga

DBGET integrated database retrieval system