KEGG   Streptomyces coelicolor: SCO6243Help
Entry
SCO6243           CDS       T00085                                 

Gene name
aceB1, SCAH10.08c
Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
sco  Streptomyces coelicolor
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO6243 (aceB1)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SCO6243 (aceB1)
   00630 Glyoxylate and dicarboxylate metabolism
    SCO6243 (aceB1)
Enzymes [BR:sco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SCO6243 (aceB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(6865736..6867358)
Genome map
AA seq 540 aa AA seqDB search
MSAPAPSTLAIVDAEPLPRQEEVLTDAALAFVAELHRRFTPRRDELLARRAERRAEIART
STLDFLPETAAIRADDSWKVAPAPAALNDRRVEITGPTDRKMTINALNSGAKVWLADFED
ASAPTWENVVLGQLNLASAYTRSIDFTDERTGKSYALRPDAELATVVMRPRGWHLDERHL
QVDGRPVPGALVDFGLYFFHNAQRLLDLGKGPYFYLPKTESHLEARLWNEVFVFAQDYVG
IPQGTVRATVLIETITAAYEMEEILYELRDHASGLNAGRWDYLFSIVKNFRDGGAKFVLP
DRNAVTMTAPFMRAYTELLVRTCHKRGAHAIGGMAAFIPSRRDAEVNKVAFEKVRADKDR
EAGDGFDGSWVAHPDLVPIAMESFDKVLGDKPNQKDRLREDVDVKAADLIAVDSLEAKPT
YAGLVNAVQVGIRYIEAWLRGLGAVAIFNLMEDAATAEISRSQIWQWINAEVVLDNGEQV
TADLARKVAAEELAGIRAEIGEEAFAAGNWQQAHDLLLTVSLDEDYADFLTLPAYEQLKG
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcaccagcgccgtccacgctggccatcgtcgacgccgagcccctgccccggcag
gaggaggtcctcaccgatgcggcgctcgccttcgtggccgagctgcaccggcggttcacg
ccccggcgtgacgagctcctcgcccgccgagcggagcgccgcgccgagatcgcccgcacc
tccacgctcgacttcctcccggagaccgccgcgatccgcgcggacgactcctggaaggtg
gcccccgccccggccgcgctgaacgaccgccgggtcgagatcaccggccccaccgaccgc
aagatgaccatcaacgcgctcaactcgggcgcgaaggtgtggctcgcggacttcgaggac
gcctccgcgccgacctgggagaacgtggtcctcggccagctcaacctggcctccgcctac
acccgcagcatcgacttcaccgacgagcgcaccggcaagtcctacgccctgcgcccggac
gccgaactggcgacggtcgtcatgcgcccgcgcggctggcacctcgacgagcgccacctc
caggtcgacggccgcccggtccccggcgccctggtcgacttcggcctgtacttcttccac
aacgcgcagcgtctgctggacctcggcaagggcccgtacttctaccttccgaagacggag
tcgcacctggaggcccgcctctggaacgaggtcttcgtcttcgcgcaggactacgtcggc
atcccgcagggcacggtccgcgccaccgtcctgatcgagacgatcacggccgcgtacgag
atggaggagatcctctacgagctgcgcgaccacgcctcggggctgaacgcggggcgctgg
gactacctgttctccatcgtcaagaacttccgtgacggcggcgcgaagttcgtcctgccg
gaccgcaacgcggtgacgatgaccgccccgttcatgcgggcgtacaccgaacttctcgtc
cgcacctgccacaagcggggcgcgcacgcgatcggcggcatggcggcgttcatcccgtcc
cgccgggacgccgaggtcaacaaggtcgccttcgagaaggtccgcgccgacaaggaccgc
gaggccggcgacggcttcgacggctcctgggtcgcccacccggacctggtcccgatcgcc
atggagtccttcgacaaggtgctcggcgacaagcccaaccagaaggaccggctgcgcgag
gacgtcgacgtcaaggcggccgacctgatcgccgtcgactccctggaggccaagccgacg
tacgccggtctggtcaacgccgtccaggtcggcatccgttacatcgaggcgtggctgcgc
ggcctcggcgccgtcgccatcttcaacctgatggaggacgcggccaccgccgagatctcc
cgctcgcagatctggcagtggatcaacgcggaggtcgtcctggacaacggcgagcaggtc
accgccgacctggcccgcaaggtcgccgccgaggagctggcgggcatccgcgccgagatc
ggcgaagaggccttcgcggccggcaactggcagcaggcccacgacctgctgctcacggtg
tcgctcgacgaggactacgccgacttcctgacgctgccggcgtacgagcagctcaagggc
tga

DBGET integrated database retrieval system