KEGG   Streptomyces coelicolor: SCO6260Help
Entry
SCO6260           CDS       T00085                                 

Gene name
SCAH10.25
Definition
sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sco  Streptomyces coelicolor
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO6260 (SCAH10.25)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO6260 (SCAH10.25)
   00052 Galactose metabolism
    SCO6260 (SCAH10.25)
   00500 Starch and sucrose metabolism
    SCO6260 (SCAH10.25)
   00520 Amino sugar and nucleotide sugar metabolism
    SCO6260 (SCAH10.25)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SCO6260 (SCAH10.25)
   00524 Butirosin and neomycin biosynthesis
    SCO6260 (SCAH10.25)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SCO6260 (SCAH10.25)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
6882242..6883390
Genome map
AA seq 382 aa AA seqDB search
MSTYRDFTAPIGSRRAPVLRTVGTRERRSHLTAPRVPTVGIDIGGTKVMAGVVDADGNIL
EKLRTETPDKSKSPKVVEDTIVELVLDLSDRHDVHAVGIGAAGWVDADRNRVLFAPHLSW
RNEPLRDRIAGRLAVPVLVDNDANTAAWAEWRFGAGRGEDHLVMITLGTGIGGAILEDGQ
VKRGKYGVAGEFGHMQVVPGGHRCPCGNRGCWEQYSSGNALVREARELAAADSPVAYGII
EHVKGSIGDITGPMITELAREGDAMCVELLQDIGQWLGVGIANLAAALDPSCFVIGGGVS
AADDLLIGPARDAFKRQLTGRGYRPEARIVRAQLGPEAGMVGAADLSRLVARRFRRAKRR
RVERYERYERYAEARRESRESL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagcacctaccgcgacttcaccgcccccatcggctcccgccgcgccccggtcctgcgc
accgtgggcacgagggaacgccgctcgcacctcacggcaccccgcgtgcccacggtcggc
atcgacatcggcggcacgaaggtcatggcgggtgtcgtcgacgccgacggcaacatcctg
gagaagctccgcacggagaccccggacaagtccaagagcccgaaggtcgtcgaggacacg
atcgtcgaactggtcctggacctctccgaccggcacgacgtgcacgccgtcggcatcggc
gcggccggctgggtcgacgccgaccgcaaccgcgtcctgttcgccccccacctgtcctgg
cgcaacgaaccgctgcgcgaccgcatcgccggccgcctcgccgtgcccgtcctggtggac
aacgacgccaacaccgccgcctgggccgagtggcgcttcggcgcgggccgcggcgaggac
cacctcgtcatgatcacgctcggcaccggcatcggcggcgcgatcctcgaggacggccag
gtcaagcggggcaagtacggcgtcgccggcgagttcgggcacatgcaggtcgtccccggc
ggccatcgctgcccgtgcggcaaccgcggctgctgggagcagtacagctccgggaacgcc
ctggtcagggaggcccgggagctggccgccgccgactccccggtggcgtacgggatcatc
gagcacgtcaagggcagcatcggcgacatcaccggcccgatgatcaccgagctggcccgc
gagggcgacgccatgtgcgtcgagctgctccaggacatcggacagtggctcggcgtcggc
atcgcgaacctcgccgcggccctcgacccgtcctgcttcgtgatcggcggcggggtcagc
gccgccgacgacctgctgatcggccccgcgcgcgacgccttcaagcgccagctcaccggc
cgcggctaccgccccgaggcccgcatcgtccgcgcccagctcggccccgaggccggcatg
gtgggcgccgccgacctgtcccggctggtcgcccgccgtttccgtcgggccaagcggcgc
cgggtggagcggtacgagcgctacgagcggtacgccgaggcccgccgtgagtcccgggag
tcgctgtga

DBGET integrated database retrieval system