KEGG   Streptomyces coelicolor: SCO6347Help
Entry
SCO6347           CDS       T00085                                 

Gene name
SC3A7.15
Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
sco  Streptomyces coelicolor
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sco00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
7004952..7006739
Genome map
AA seq 595 aa AA seqDB search
MKRSTLSYTDGTLLRNGRPHRLLAGSLHYFRVHPGHWADRLRRLAALGLNAVDTYVPWNF
HERTAGDIRFDGPRDLARFIRLAQEEGLDVVVRPGPYICAEWDNGGLPAWLTGTPGMRLR
TSHGPYLEAVDRWFDALVPRIAELQAGRGGPVVAVQIENEYGSYGDDRAYVRHIRDALVA
RGITELLYTADGPTPLMQDGGALPGELAAATFGSRPDRAAALLRSRRPAEPFFCAEFWNG
WFDHWGDKHHVRPAPSAAEDLGGILDEGGSVSLYMAHGGTNFGLWAGANHEGGTIRPTVT
SYDSDAPIAENGALTPKFFALRDRLTALGTAATRRPLPADPPLLAPRDLPVLRQAALLDA
LRATAEPVTAPLPLSFEELSLASGLVLYEAEPLLPPGEHEVTVTGLHDRAQVFADDTPVA
VLDRESASFTVTGTGARVRLALLVENQGRINYGPLLGQGKGILGGVRVERRLVHGWTMRP
LPLDAWTGRDTARAAAAAPSDGRAGFATAVLPVAEPADAFVALPGFGKGFLWVNDTLLGR
YWEIGPQSTLYLPGPLLRPGGNTLTVLELERLGDRVALREGPDLGPSEEYVETFD
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcggtccaccctgtcgtacaccgacggcaccctcctgcggaacgggcgcccgcac
cgtctgctggcgggctcgctgcactacttccgggtgcaccccgggcactgggccgaccgg
ctccggcggctggccgccctcggcctgaacgcggtcgacacctacgtcccctggaacttc
cacgagcgcaccgcgggcgacatccgcttcgacggcccgcgcgacctggcccggttcatc
cggctcgcccaggaggaggggctggacgtcgtcgtgcggccgggcccctacatctgcgcc
gagtgggacaacggcggtctgcccgcctggctgaccggcactcccggcatgcggctgcgc
acctcccacggcccctacctcgaagcggtcgaccgctggttcgacgcgctcgtcccgcgg
atcgcggaactccaggccggccggggcggaccggtcgtggccgtgcagatcgagaacgag
tacggcagctacggcgacgaccgcgcgtacgtccgccacatccgggacgccctcgtcgcc
cggggcatcaccgaactgctctacaccgcggacggaccgaccccgctgatgcaggacggc
ggcgccctgcccggcgaactggccgcggcgaccttcggctcacgccccgaccgggccgcg
gcgctgctgcgctcccgccggcccgcagagcccttcttctgcgccgagttctggaacggc
tggttcgaccactggggcgacaagcaccacgtccggccggccccgagcgcggccgaggac
ctcggcggcatcctcgacgagggcggctccgtgagcctctacatggcgcacggcggcacc
aacttcggactgtgggcgggcgccaaccacgagggcggcaccatccgtccgaccgtcacc
agctacgactcggacgcccccatcgccgagaacggcgccctgaccccgaagttcttcgcc
ctgcgggacaggctgaccgcgctcggcaccgccgcgacccggcgcccgctgcccgccgac
ccaccgctgctggcaccccgcgacctgccggtcctccggcaggcggccctgctcgacgcc
ctgcgggcgacggccgagcccgtgaccgcaccgctgccgctgagcttcgaggaactgtcc
ctggcctcgggcctggtcctctacgaggccgagccgctgctgccgccgggggagcacgag
gtgaccgtcacgggtctgcacgaccgcgcccaggtcttcgccgacgacacacccgtcgcc
gtactggaccgcgagagcgcctcgttcaccgtcaccggcaccggagcacgggtccggctg
gcgctgctggtggagaaccagggacggatcaactacggtccgctgctcggccagggcaag
ggcatcctcggcggggtgcgggtggagcgccgactggtgcacggctggacgatgcgtccg
ctgccgctcgacgcgtggacggggcgggacacggcacgcgccgcggcggcggccccctcg
gacggccgggccggattcgccaccgccgtcctgccggtggccgagcccgcggacgccttc
gtcgcgctgcccgggttcggcaagggcttcctctgggtcaacgacaccctgctgggccgc
tactgggagatcggcccccagagcacgctctacctgcccggtccgctcctgcgccccggc
ggcaacaccctgaccgtgctggaactcgaacgcctcggcgaccgcgtcgccctgcgcgag
ggccccgacctcggaccgtcggaggagtacgtcgagaccttcgactga

DBGET integrated database retrieval system