KEGG   Streptomyces coelicolor: SCO6353Help
Entry
SCO6353           CDS       T00085                                 

Gene name
SC3A7.21c
Definition
(RefSeq) two-component sensor
Organism
sco  Streptomyces coelicolor
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HATPase_c_2
Motif
Other DBs
NCBI-GeneID: 1101794
NCBI-ProteinID: NP_630445
Kitasato: SCO6353
UniProt: O86622
Position
complement(7014907..7016286)
Genome map
AA seq 459 aa AA seqDB search
MSGTRHRTRPALTAFLHRLAPRTLRGRLSLVALTTAALLMLILTVAFNAVAQHRLQHQAD
DELRTRAAAVATTIDTTGTTVRVLETSNDALLDTNVWIYADGRLLEEPPNAGPLTRVADA
LAGHGGRRCVTAGVDGPLRLCSQPVSGDNSEATVVTALGLSPYRSSADTLLLGSLALDAV
MLACTYALTRLAVGRALRPVRTMTDQATQWSAVASEERFGHTRHPSELTRLGTSLDAILD
RIRTLLRHERQLTGELSHELRTPLSRIIAELDWWQTRPRTADQTHATHKVIAEAAQSMRT
ICDTLLDDARGGAPTAPGTAEILPTLRRLTEVLDAPSHLTVTADGPPLEAGVPPALLERI
ISPLLTNASRYARSKITVHAYRAPDGVRIEVIDDGPGVPPPFAGQLFEPGRRADPGDGHS
GAGLGLPLARRLARSAGGEMTYDPDHTPGARFVVSLPAG
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcacccgccaccggacgcggcccgccctgaccgccttcctccaccgtctggcg
ccccgcacgctgcgcggccggctctccctcgtggccctcaccacggccgcgctgctgatg
ctgatcctcaccgtcgccttcaacgccgtggcccagcaccgcctccagcaccaggcggac
gacgagctgcgcacccgagccgccgccgtcgcgacgaccatcgacaccaccggcacgacc
gtacgagtcctggaaacctccaacgacgccctcctcgacaccaacgtgtggatctacgcc
gacggacgcctgctggaagagcccccgaacgccgggcccctcacccgcgtcgccgacgcc
ctcgccgggcacggcgggcggcggtgcgtcaccgccggcgtcgacggccctctccggctg
tgctcgcaaccggtgtccggagacaacagcgaggccacggtggtcaccgccctcggcctc
tccccgtaccggagttcggccgacaccctgctcctgggctcactcgccctggacgccgtg
atgctcgcctgcacctacgccctgacccggctggcggtaggccgcgcactgcgcccggtc
cgcacgatgaccgaccaggccacccagtggagcgccgtcgcctccgaagaacgcttcggc
catacgcggcacccgtccgaactcacgcgcctcggtacatcactggacgccatactggac
cgcatccgcaccctcctgcgccacgagcggcagctcaccggggaactctcgcacgagctg
cgcacacccctgagccgaatcatcgccgaactcgactggtggcagacccgcccccgcacc
gccgaccagacccacgccacccacaaggtcatcgcggaagccgcccagtccatgcgcacc
atctgcgacaccctcctcgacgacgcccgcggcggcgcacccaccgctcccggcaccgcc
gagatcctccccacgctgcgacgcctcaccgaagtcctcgacgcaccatcccacttgacg
gtcaccgccgacggcccgcccctggaggccggagtcccacccgccctcctcgaacgcatc
atcagcccgctcctgaccaacgccagccgatacgcccgatccaagatcaccgtccacgcc
taccgcgcacccgacggcgtacgcatcgaggtcatcgacgacggccccggcgtaccgccc
ccgttcgccggacagctcttcgagcccggccgacgcgcggatcccggcgacggacacagc
ggagcgggcctgggactgccgctggcgcgacgcctggcccgctccgccggaggcgagatg
acgtacgaccccgaccacacccccggggcacggtttgtggtcagcctgcctgccgggtga

DBGET integrated database retrieval system