KEGG   Streptomyces coelicolor: SCO6457Help
Entry
SCO6457           CDS       T00085                                 

Gene name
SC9B5.24
Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
sco  Streptomyces coelicolor
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sco00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:sco00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:sco00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
7142206..7146129
Genome map
AA seq 1307 aa AA seqDB search
MPHSPVSPAESPAPQPGRPRPVVSRRRLLEGGAAVLGALALSASPLTAQAAVRRAAADEP
PEWNDFGVFRLGTQPPHATLTPYADVEQALAGDRARSPYRLSLDGTWKFAYADRPEDRDA
DFHRTDVDDGDWGTIPVPSVWQLHGHDFPIYLNITYPYWGPNGQGEEPQPPAAPTRYNPV
GQYRRTFTVPRDWRGRRTFLHFEGVKSAHYVWINGELAGYDEDSYTPSEYDVTDLLKPGT
NQIAVEVYRYSDGDWMEDQDMIRLSGIFRSVHLYSTPAVHLRDFKLDTPLDDTYTGAELA
VTASVRAYGEGGTGRYTVETQLYDARGHAVWSRPLQQPVDVGGARAGEDVTVRAAKAVPK
PRLWSAEHPDLYTAVLRLRDPAGKVTETLSHRVGFREFALKDGLMRINGEPVSIRGTNRH
EMHPARGTALTREDMVEDIKIIKRMNMNSVRTSHYPNNPYWLELADEYGLYLVDETNLET
HGIRGEYPGDHPDWTAACVARAQNMVHRDKNHASVVIWSLGNEAGGGSTFSAMHDWIRSY
DDTRVIQYEGDDRPGVSDIRSEMYDSPQRVEQRAKDTSDTRPYVMIEYAHSMGNSTGNFK
KYWDVVRRYDVLQGGWIWDFVDQSLYTPVPARTLLTEAGPAGLRGEILATRGTLDRDEGL
SGITVFERHDSLDLTGSLTLEAWVTPHVTGYHQPIIAKGDTQYALKQNGRTLEFFIHSEG
QWITANWTVPEDWTGREHHLAGVFDADAGTLTLYVDGVERATRTTDRRPSSNTAPLALAS
DADNQVREFSGTVRRARVYARALGAAELASESRGPGDDGVRFWFDAATVKTSTRRPRDKT
FLAYGGDWGDNPNDGAFVADGIVTADRGHTGKAAEVKRVYQAIDAARTPGGGPGAVTLTN
EYLFTRLREFDGHWELVADGEVVRRGRLTRDQLDVAPRSSKDITVPVRLPGRPGPGTEYF
LQLSFTTKESTPWAKAGFEVARRQLPVAADVPAVTPVRAASVPALRHEDRDREVEVTGRG
FSVTVDKRTGTISSYEAKGTRLITSGPVPNFWRAPTDNDKGNGQHTRNQTWRDAGARRKV
TGVIVRALGDRAVEIKVTGTLPTSVESTYGTTYTVFGNGEIKVDNTLHPGAANLPYIPEV
GTMLFLPRGLDRVHWYGRGPEENHWDRNDGTDVGRYSGTVAEQWTPYIRPQENGNKTDVR
WIALTDRHGVGLLASGEPLLEANASYFTPEDLSAGVRHDYQLTPRDEVVLRLNHRQMGVG
GDNSWGAHTHDEFKLFADRDYAYTYRLRPLTDVRDATRASRRPTATE
NT seq 3924 nt NT seq  +upstreamnt  +downstreamnt
atgccgcactcgcccgtgtcacccgccgaatccccggccccccagcccggccggccccgc
ccggtcgtcagccgccgccgcctcctggagggcggtgccgccgtcctcggcgccctcgcg
ctgtccgcgtcgcccctcacggcacaggcggccgtacggcgggcggcggccgacgagccg
ccggagtggaacgacttcggcgtcttccggctcggcacccagccgccgcacgccacgctc
acgccgtacgcggacgtcgagcaggcgctcgccggcgaccgcgcccgctcgccctaccgg
ctcagcctggacggcacctggaagttcgcctacgccgaccgtcccgaggaccgggacgcc
gacttccaccgcaccgacgtggacgacggggactgggggaccatccccgtcccgtccgtg
tggcagctgcacggccacgacttccccatctacctgaacatcacctacccgtactggggt
cccaacggccagggcgaggagccgcagccgcccgccgcgccgacccgctacaacccggtc
ggccagtaccggcgcaccttcaccgtcccccgggactggaggggccgtcgcaccttcctc
cacttcgagggcgtcaagtccgcgcactacgtctggatcaacggcgaactggccggctac
gacgaggactcctacacgccctccgagtacgacgtcaccgacctcctcaagccgggcacc
aaccagatcgccgtcgaggtctaccgctactccgacggcgactggatggaggaccaggac
atgatccggctgagcggcatcttccgctcggtccacctctactccaccccggccgtgcac
ctgcgcgacttcaagctggacaccccgctcgacgacacctacaccggcgccgaactggcc
gtcaccgcgagcgtgcgggcgtacggcgagggcggcacgggccgctacaccgtcgagacc
cagctgtacgacgcgcgcggccacgccgtctggtcccggccgctgcaacagcccgtcgac
gtcggcggggcccgcgcgggcgaggacgtcacggtgcgggccgcgaaggcggtgccgaag
ccccggctctggtccgccgaacaccccgacctctacacggccgtcctgcgcttgcgcgat
cccgccgggaaggtgaccgagaccctgtcgcaccgggtcggcttccgcgagttcgcgctc
aaggacgggctgatgcggatcaacggcgagccggtgtccatccgcggcaccaaccgccac
gagatgcaccccgcccgcggcaccgcgctcacccgcgaggacatggtcgaggacatcaaa
atcatcaagcggatgaacatgaacagcgtccgcacctcgcactaccccaacaacccctac
tggctcgaactggccgacgagtacggcctctacctcgtcgacgagaccaacctggagacg
cacggcatccgcggcgagtaccccggcgaccacccggactggaccgccgcctgcgtggcc
cgcgcccagaacatggtgcaccgcgacaagaaccacgcctcggtcgtcatctggtcgctg
ggcaacgaggcgggcggcggctccaccttcagcgccatgcacgactggatccgctcctac
gacgacacccgcgtcatccagtacgagggcgacgaccgccccggcgtcagcgacatccgc
tcggagatgtacgacagcccgcagcgcgtcgagcagcgcgcgaaggacacctccgacacc
cggccgtacgtcatgatcgagtacgcccactcgatggggaactccaccggcaacttcaag
aagtactgggacgtcgtccgccgctacgacgtcctccagggcggctggatctgggacttc
gtcgaccagtccctctacacgcccgtccccgcccgcaccctgctcaccgaggccgggccc
gccgggctgcgcggggagatcctcgccacccgcggcaccctcgaccgcgacgagggcctg
tccggcatcaccgtcttcgagcgccacgacagcctcgacctcacgggctcactgaccctg
gaggcctgggtcaccccgcacgtgacgggctaccaccagccgatcatcgccaagggcgac
acccagtacgcgctgaagcagaacggccggaccctggagttcttcatccactccgaaggc
cagtggatcaccgcgaactggaccgtgccggaggactggaccggccgcgagcaccacctc
gcgggcgtcttcgacgcggacgccgggaccctgaccctctacgtcgacggcgtcgaacgg
gccacccgcaccaccgaccggcgccccagcagcaacaccgcgcccctcgcgctcgcctcc
gacgccgacaaccaggtgcgggagttcagcggcaccgtccgccgcgcccgcgtctacgcc
cgcgccctcggcgccgccgaactggcctccgagagccgcggacccggcgacgacggtgtg
cggttctggttcgacgccgccacggtgaagacctcgacgcggcgcccccgggacaagacg
ttcctcgcctacggcggcgactggggcgacaaccccaacgacggcgccttcgtcgcggac
ggcatcgtcaccgccgaccgcggccacaccggcaaggccgccgaggtcaagcgcgtctac
caggcgatcgacgccgcccgcaccccgggcggcggccccggcgccgtcaccctcaccaac
gagtacctcttcacccgcctccgcgagttcgacgggcactgggaactcgtcgccgacggc
gaggtcgtacggcgcgggaggctgacccgggaccaactggacgtggcaccgcgctccagc
aaggacatcaccgtccccgtccggctgccggggcgacccggcccgggtaccgagtacttc
ctccagctctccttcaccaccaaggagtccaccccgtgggcgaaggcgggcttcgaggtg
gcccgccggcagctccccgtcgcggccgacgtcccggcggtgaccccggtccgcgcggcg
agcgtgccggccctgcgccacgaggaccgcgaccgggaggtcgaggtcaccggcaggggc
ttctcggtcaccgtcgacaagcgcaccggcaccatcagctcctacgaggccaagggcacc
cggctgatcacctcgggaccggtgcccaacttctggcgcgcgcccaccgacaacgacaag
ggcaacggccagcacacccgcaaccagacctggcgcgacgcgggcgcccgccggaaggtc
accggcgtcatcgtgcgcgcgctcggcgaccgggccgtcgagatcaaggtcaccggcacg
ctgcccacctcggtggagtccacgtacggcaccacctacacggtgttcggcaacggcgag
atcaaggtcgacaacaccctgcacccgggcgccgcgaacctgccctacattcccgaggtc
ggcacgatgctgttcctgccgcgcggcctggaccgcgtgcactggtacggccgcggcccc
gaggagaaccactgggaccgcaacgacggcacggacgtcggccgctactccgggaccgtc
gccgagcagtggacgccgtacatccgcccgcaggagaacggcaacaagaccgacgtccgc
tggatcgccctcaccgaccgccacggcgtgggcctgctcgcctccggcgaacccctcctg
gaggccaacgcgtcgtacttcacgccggaggacctgtcggccggcgtgcggcacgactac
cagctcaccccgagggacgaggtcgtcctgcggctgaaccaccggcagatgggcgtcggc
ggcgacaacagctggggcgcgcacacccacgacgagttcaagctcttcgccgaccgggac
tacgcgtacacctaccggctgcgcccgctcaccgacgtgcgcgacgcgacgcgcgcctcg
cgacggccgacggcgacggaatag

DBGET integrated database retrieval system