KEGG   Streptomyces coelicolor: SCO6585Help
Entry
SCO6585           CDS       T00085                                 

Gene name
sucC
Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sco  Streptomyces coelicolor
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:sco01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:sco00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:sco00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:sco00660]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
7295341..7296492
Genome map
AA seq 383 aa AA seqDB search
MDLYEHQARELFKEHGIVVPRAEVTDSPERAREIARALGGRAVVKAQVKTGGRGKAGGVR
LAADPAEAEEAARHILGMDIRGHTVDTVMLAEPCEIEREFYVSYVLDRASGGFLAIASAE
GGTEIEEVAARRPEAVARIPVDPATGVHTATAVRIADAAGLPPQTVDTLVRLWKVLVRED
ALLVEVNPLVRTAEGRIVALDGKVTLDDNARFRQSRWGETRQEDADSLEARAGAKGLNYV
KLDGEVGVIGNGAGLVMSTLDVVAGCGARPANFLDIGGGASARVMADGLSVVLSDPDVRS
VLVNVFGGITACDAVADGIVRALDEVRLTKPLVVRLDGNNAARGRALLDARAHPLVEQAT
TMDGAARRAARLATAASTAGQAG
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggacctgtacgaacaccaggcaagggaactcttcaaggaacacgggatcgtggtcccg
agggccgaggtcaccgactcgcccgaacgggcccgggagatcgcccgcgcactcggcgga
cgcgccgtcgtcaaggcgcaggtgaagaccggcgggcgcggcaaggcgggcggagtgcgg
ctcgccgccgacccggccgaggccgaggaggcggcgcggcacatcctcggcatggacatc
aggggacacacggtcgacaccgtcatgctggccgaaccctgcgagatagagcgggagttc
tacgtctcctacgtcctcgaccgggcgtccggcggcttcctcgccatcgcctccgcggag
ggcggcacggagatcgaggaggtcgccgcccggcggcccgaggccgtggcgcgcatcccc
gtcgaccccgccacgggcgtgcacacggccaccgcggtacgcatcgccgacgccgccggc
ctgcccccgcagaccgtcgacacgctggtgcggctgtggaaggtactggtccgcgaggac
gccctcctggtcgaggtcaacccgttggtcaggacggccgagggccggatcgtggccctc
gacggcaaggtcaccctcgacgacaacgcccgcttccgacagtcccgttggggcgagacg
aggcaggaggacgccgactccctggaggcgcgggccggcgccaagggcctcaactacgtc
aagctggacggcgaggtcggcgtcatcggcaacggcgccgggctggtcatgtcgacactc
gacgtggtcgccggctgcggtgcccgccccgccaacttcctcgacatcggcgggggcgcc
tccgcccgggtcatggccgacggactgtccgtcgtgctctccgaccccgacgtgaggtcc
gtcctcgtcaacgtcttcggcggcatcaccgcctgcgacgcggtcgccgacggcatcgtc
cgcgccctggacgaggtccggctcaccaaaccgctcgtcgtacgcctcgacgggaacaac
gccgcgcggggccgggccctgctcgacgcccgcgcgcaccccctggtcgaacaggccacc
accatggacggcgccgcccgccgtgccgcccggctcgccaccgcggcgtccaccgccgga
caggccggataa

DBGET integrated database retrieval system