KEGG   Streptomyces coelicolor: SCO6585Help
Entry
SCO6585           CDS       T00085                                 

Gene name
sucC
Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sco  Streptomyces coelicolor
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO6585 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCO6585 (sucC)
   00640 Propanoate metabolism
    SCO6585 (sucC)
   00660 C5-Branched dibasic acid metabolism
    SCO6585 (sucC)
Enzymes [BR:sco01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SCO6585 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
7295341..7296492
Genome map
AA seq 383 aa AA seqDB search
MDLYEHQARELFKEHGIVVPRAEVTDSPERAREIARALGGRAVVKAQVKTGGRGKAGGVR
LAADPAEAEEAARHILGMDIRGHTVDTVMLAEPCEIEREFYVSYVLDRASGGFLAIASAE
GGTEIEEVAARRPEAVARIPVDPATGVHTATAVRIADAAGLPPQTVDTLVRLWKVLVRED
ALLVEVNPLVRTAEGRIVALDGKVTLDDNARFRQSRWGETRQEDADSLEARAGAKGLNYV
KLDGEVGVIGNGAGLVMSTLDVVAGCGARPANFLDIGGGASARVMADGLSVVLSDPDVRS
VLVNVFGGITACDAVADGIVRALDEVRLTKPLVVRLDGNNAARGRALLDARAHPLVEQAT
TMDGAARRAARLATAASTAGQAG
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggacctgtacgaacaccaggcaagggaactcttcaaggaacacgggatcgtggtcccg
agggccgaggtcaccgactcgcccgaacgggcccgggagatcgcccgcgcactcggcgga
cgcgccgtcgtcaaggcgcaggtgaagaccggcgggcgcggcaaggcgggcggagtgcgg
ctcgccgccgacccggccgaggccgaggaggcggcgcggcacatcctcggcatggacatc
aggggacacacggtcgacaccgtcatgctggccgaaccctgcgagatagagcgggagttc
tacgtctcctacgtcctcgaccgggcgtccggcggcttcctcgccatcgcctccgcggag
ggcggcacggagatcgaggaggtcgccgcccggcggcccgaggccgtggcgcgcatcccc
gtcgaccccgccacgggcgtgcacacggccaccgcggtacgcatcgccgacgccgccggc
ctgcccccgcagaccgtcgacacgctggtgcggctgtggaaggtactggtccgcgaggac
gccctcctggtcgaggtcaacccgttggtcaggacggccgagggccggatcgtggccctc
gacggcaaggtcaccctcgacgacaacgcccgcttccgacagtcccgttggggcgagacg
aggcaggaggacgccgactccctggaggcgcgggccggcgccaagggcctcaactacgtc
aagctggacggcgaggtcggcgtcatcggcaacggcgccgggctggtcatgtcgacactc
gacgtggtcgccggctgcggtgcccgccccgccaacttcctcgacatcggcgggggcgcc
tccgcccgggtcatggccgacggactgtccgtcgtgctctccgaccccgacgtgaggtcc
gtcctcgtcaacgtcttcggcggcatcaccgcctgcgacgcggtcgccgacggcatcgtc
cgcgccctggacgaggtccggctcaccaaaccgctcgtcgtacgcctcgacgggaacaac
gccgcgcggggccgggccctgctcgacgcccgcgcgcaccccctggtcgaacaggccacc
accatggacggcgccgcccgccgtgccgcccggctcgccaccgcggcgtccaccgccgga
caggccggataa

DBGET integrated database retrieval system