KEGG   Streptomyces coelicolor: SCO6732Help
Entry
SCO6732           CDS       T00085                                 

Gene name
SC5F2A.15
Definition
fatty acid oxidative multifunctional enzyme
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
sco  Streptomyces coelicolor
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO6732 (SC5F2A.15)
   01212 Fatty acid metabolism
    SCO6732 (SC5F2A.15)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SCO6732 (SC5F2A.15)
   00650 Butanoate metabolism
    SCO6732 (SC5F2A.15)
  Lipid metabolism
   00071 Fatty acid degradation
    SCO6732 (SC5F2A.15)
   01040 Biosynthesis of unsaturated fatty acids
    SCO6732 (SC5F2A.15)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCO6732 (SC5F2A.15)
   00310 Lysine degradation
    SCO6732 (SC5F2A.15)
   00380 Tryptophan metabolism
    SCO6732 (SC5F2A.15)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SCO6732 (SC5F2A.15)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SCO6732 (SC5F2A.15)
   00281 Geraniol degradation
    SCO6732 (SC5F2A.15)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    SCO6732 (SC5F2A.15)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SCO6732 (SC5F2A.15)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SCO6732 (SC5F2A.15)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SCO6732 (SC5F2A.15)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
7485381..7487561
Genome map
AA seq 726 aa AA seqDB search
MSTEPTTIRWEQDDTGVVTLVLDDPDQSANTMNQAFRDSLAAVTDRLEAEKDSIRGVIVT
SAKKTFFAGGDLRDLIRVTPETAQDLFDGGMAIKRNLRRIETLGKPVVAALNGAALGGGY
EIALACHHRVALDAPGSKIGCPEVTLGLLPGGGGVVRTVRMLGITDALLKVLLQGTQYNP
RRAQENGLVDEVADSREDMLAKARAFIDAHPESAQPWDRPGYRIPGGTPSHPKFAANLPA
FPANLRKQTNGAPYPAPRNIMAAAVEGSQVDFETAQVIEARYFVELAAGQTSKNMIQAFF
FDLQAVNSGANRPKGVEPGKVAKVAVLGAGMMGAGIAYSCARAGIDVVLKDVSLESALKG
KAYSEKLCAKAVAKGRTSQEKAAALLARITPTAEAADLAGCDAVIEAVFEDTSLKHKVFQ
EIEHVVAPDALLCSNTSTLPITALAEGVERQGDFIGLHFFSPVDRMPLVEIIKGERTGDE
ALARAFDLVRQIGKTPIVVNDSRGFFTSRVIGHFINEGVAMVGEGIEPASVEQAAAQAGY
PAKVLSLMDELTLTLPRKIREETKRAVEEAGGTWAAHPAEALIDRMVDEFGRPGRSGGAG
FYEYGEDGRRAGLWPGLREHFTKPGYEIPFADMQERMLFSEALDTVRLLEEGVLTSVADA
NIGSIFGIGFPGWTGGVLQYINGYDGGVPGFVARARELADRYGERFTPPALLVEKADNGE
VFTDGR
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgagcccaccaccatccgctgggagcaggacgacaccggtgtcgtcaccctc
gtcctcgacgaccccgaccagtccgcgaacaccatgaaccaggcgttccgcgactccctg
gcggcggtcaccgaccgcctggaggccgagaaggactcgattcgcggcgtcatcgtcacc
tccgccaagaagaccttcttcgcgggcggcgacctgcgcgacctcatccgcgtcaccccg
gagaccgcgcaggacctcttcgacggcggcatggccatcaagcggaacctgcgccgcatc
gagaccctcggcaagcccgtcgtcgccgccctgaacggcgcggccctcggcggcggctac
gagatcgcgctggcctgccaccaccgcgtcgccctggacgcccccggctccaagatcggc
tgccccgaggtcaccctcggcctgctccccggaggcggcggagtcgtccgcaccgtccgg
atgctcggcatcaccgatgccctgctgaaggtcctcctccagggcacccagtacaacccg
cgccgcgcccaggagaacggcctggtcgacgaggtcgccgacagccgcgaggacatgctc
gccaaggcccgcgccttcatcgacgcccacccggagtccgcccagccctgggaccggccc
ggttaccgcatccccggcggcaccccgtcccacccgaagttcgcggccaacctgcccgcc
ttccccgccaacctgcgcaagcagacgaacggcgccccctacccggcgccgcgcaacatc
atggccgccgccgtcgagggctcccaggtcgacttcgagaccgcccaggtcatcgaggcc
cgctacttcgtcgaactggccgccgggcagacctcgaagaacatgatccaggcgttcttc
ttcgacctgcaggcggtcaattccggtgccaaccgtccgaagggtgtcgagccggggaag
gtcgccaaggtggccgtgctgggtgcggggatgatgggtgcgggcatcgcctactcgtgt
gcgcgtgcgggcatcgacgtggtgctgaaggacgtctccctggagtcggcgctcaagggc
aaggcgtattcggagaagctgtgcgccaaggccgtcgcgaagggccgtacgagtcaggag
aaggcggccgcgctgctggcgcggatcacgccgacggccgaggcggccgacctggcgggg
tgcgacgcggtgatcgaggcggtgttcgaggacacctcgctcaagcacaaggtgttccag
gagatcgagcacgtcgtcgcccccgacgccctgctgtgctcgaacacctccacgctgccg
atcacggcgctggccgagggggtggagcggcagggcgacttcatcgggctgcacttcttc
tcacccgtggacaggatgccgctggtggagatcatcaagggcgagcggaccggggacgag
gccctggcccgcgccttcgacctggtccggcagatcggcaagacgccgatcgtggtcaac
gactcgcggggcttcttcacctcccgggtcatcggccacttcatcaacgagggcgtggcg
atggtgggggagggcatcgagcccgcctcggtggagcaggcggcggcccaggcgggttac
ccggccaaggtgctgtccctgatggacgagctgaccctcaccctcccccgcaagatccgc
gaggagacgaagcgggcggtggaggaggcgggcggcacctgggcggcgcatcccgccgag
gcgctcatcgaccgcatggtcgacgagttcggccgcccgggacgctccggaggtgccggg
ttctacgagtacggcgaggacggcaggcgggccggactgtggccggggctgcgcgagcac
ttcacgaagccggggtacgagatcccgttcgccgacatgcaggagcggatgctgttctcg
gaggcgctggacaccgtccggctcctggaggagggggtgctgacctccgtcgccgacgcc
aacatcggctcgatcttcggcatcggcttccccggctggaccggcggcgtcctccagtac
atcaacggatacgacggcggcgtgccgggcttcgtcgcccgcgcccgcgagctggccgac
cgctacggcgagcgcttcaccccgcccgccctgctggtggagaaggcggacaacggggag
gtcttcacggacggccgctga

DBGET integrated database retrieval system