KEGG   Streptomyces coelicolor: SCO6928Help
Entry
SCO6928           CDS       T00085                                 

Gene name
SC1B2.34c
Definition
O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sco  Streptomyces coelicolor
Brite
Enzymes [BR:sco01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     SCO6928 (SC1B2.34c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(7692907..7694997)
Genome map
AA seq 696 aa AA seqDB search
MTADEWPQRLIRFTDWSHAEATAVEHLLPVLIAQESELAQWSFLRKHPWWRLRYRPACPD
SAKALDAALDELVDAGVLASWTRGIYEPEETAFGGPAAMKIAHALFHYDSRHLLDEAARQ
QTVSGPRLGRRELAVLLLSVAMRAAGLDWYEQGDVWARIAAERSGDEVRSPQRHRAAVHR
LMTVDVSTTSRSVARGRLAPLAEWIATFEWFGQQLADLNRQGRLERGLRAVIAHHGIFHF
NRLGLAAQDQHTLSTLAKEVVMGTSDNAASTQAEGAPGATVNGVNSDTIEAPSADRLRAQ
LIDHLVETGCVRTPRVEEAMRTVPRHLFVPNAPLEKAYGNAPVDTKFDGSGRSISCASQP
DIVAMMLEQLDVQPGQKILELGAGTGFNAGLLGYLVGETGHVTTIDVDEDIVAGARGGLA
AAGIHNVEVILGDGAVGHTPNAPYDRIEATVGAHGVPHAWLDQLAPGGRLLTPLRLRGSV
SRSIAFENQDGAWRSVGSQMNTFMPLRRGIADDPRLFVPLDPDHTVTLVTNGDQKVDADA
LGDIFRQPRTEAWTDVTFRGPESAEYLELWLTCAMPNGLSRMPAKNEAIEKGLVTAPYPS
STAVFEDGTLTYLTRRPYAKKAPDGATLYEFGVIGHGPDAEALAGDVADQIRAWDQDFRA
LDVGFEIQPLDAAPLAPKPGRFAFDNPLNRIVIEWQ
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atgactgcggacgaatggccgcaacgcctcatccggttcaccgactggagtcacgcggag
gccaccgccgtggagcatctactcccggtgctgatcgcccaggagtcggaactggcccag
tggtcgttcctgcggaagcacccctggtggcggttgcggtaccggcccgcgtgcccggac
tcggcgaaggccctggacgctgccctggacgagctggtcgacgccggcgtcctcgcctcc
tggacgcgaggcatctacgaaccggaagagacggccttcggcggccccgccgcgatgaag
attgcgcacgccctgttccactacgacagccgtcacctgctggacgaggcggcccgccag
cagacagtgagcggcccccggctcggccggcgcgagctggcggtcctcctgctcagcgtg
gcgatgcgagcggcgggcctcgactggtacgagcagggcgacgtctgggcgaggatcgcg
gccgagcgctccggcgacgaggtccgtagtccgcaacggcaccgggccgctgtccaccgg
ttgatgaccgtcgacgtcagcaccaccagccgcagcgtcgcccggggccgactggcgccg
ctggccgagtggatagccaccttcgagtggttcggccagcagctcgccgacctcaaccgc
cagggccgcctggaacgagggctgcgggccgtgatcgcccaccacggcatcttccacttc
aaccgcctgggccttgccgcccaggaccagcacaccttgtcaacactcgcgaaagaggta
gtcatgggaacgagcgacaacgccgcgtccacccaagctgagggggcaccgggcgctacg
gtcaacggggtgaacagtgacaccatcgaagccccttccgccgaccgtctgcgcgcccag
ttgatcgaccacctggtcgagaccgggtgcgtgcgcaccccccgggtggaggaggccatg
cggaccgtgccccgtcacctcttcgtcccgaacgcgcccctggagaaggcgtacggcaac
gcgcccgtggacacgaagttcgacggatccgggcgctccatcagctgcgcctcacagccc
gacatcgtcgccatgatgctggaacagctcgacgtccagcccggccagaagatcctggag
ctgggggcaggcaccggcttcaacgccggactcctgggctacctcgtcggcgagacggga
cacgtcactacgatcgacgtggacgaggacatcgtggccggagcgcgcggcggcctggcc
gccgccggcatccacaacgtggaggtgatcctcggagacggagcagtcggccacaccccc
aacgcgccgtacgaccgcatcgaagccaccgtcggcgcccacggcgtcccgcacgcctgg
ctcgaccagctcgcccctggcggacggctcctcaccccgctgcgcctgcgcggcagcgtc
tcccgctcgatcgcctttgagaaccaggacggagcctggcgcagcgtcggcagtcagatg
aacacgttcatgcctctgcgccggggcatcgccgacgacccgcgcctcttcgtacccctg
gaccccgaccacaccgtcaccctcgtcaccaacggagaccagaaggtcgacgcggacgcc
ctcggcgacatcttccgccagccgcgcaccgaggcgtggacggacgtcaccttccgcggc
ccggagtcggcggagtacctggagctgtggctcacctgcgccatgcccaacggcctgagc
cggatgcccgccaagaacgaggccatcgagaaggggctggtcaccgcgccctacccgtcc
tcgaccgcggtcttcgaggacggcaccctcacctacctcacccggcgcccgtacgcgaag
aaggcccccgacggcgccaccctgtacgagttcggtgtcatcggccacggccccgacgcc
gaggccctcgccggggacgtcgcggaccagatccgcgcctgggaccaggacttccgagcg
ctcgacgttggcttcgagattcagccgctcgacgcggccccgctcgcgccgaagcccggc
cgcttcgccttcgacaacccgctgaaccgcatcgtcatcgaatggcagtga

DBGET integrated database retrieval system