KEGG   Streptomyces coelicolor: SCO7049Help
Entry
SCO7049           CDS       T00085                                 

Gene name
SC4G1.15
Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
sco  Streptomyces coelicolor
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:sco00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sco00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:sco00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
7839207..7840130
Genome map
AA seq 307 aa AA seqDB search
MSTPTTFRPVLERIAEEIERTPGSGRPADYIPALAARDPRRFGMAVAELDGTVYGVGDWR
EPFSAQSLTKVFTLALDLAREGDALWEHVGREPSGNPFNSLVQLEYENGIPRNPFINAGA
LVVTDRLHTRTGDAAGELLAFLRAESGNPDLGHDEEVAASEAAHGDRNAALAHFMASYGN
IDNPVPVLLDQYFRQCSVAASCADLALATGFLARHGIRADGTRLLSRSRAKQINAVMLTC
GTYDAAGDFAHRVGLPGKSGVGGGIIAVVPGHCTLCVWGPGLDERGNSVAGVAALDRFTT
LTGLSVF
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaccgacgaccttccggccggtcctggagcgcatcgccgaggagatcgagcgg
accccgggcagcggccggcccgccgactacatccccgccctcgccgcccgcgacccgcgc
cgcttcggcatggccgtcgccgagctggacggcacggtctacggggtgggggactggcgg
gagccgttctccgcgcagtccctcaccaaggtcttcaccctcgccctcgacctggccagg
gagggcgacgccctgtgggagcacgtgggccgcgagccgtccggcaacccgttcaactcc
ctggtgcagctggagtacgagaacggcatcccgcgcaacccgttcatcaacgcgggcgcc
ctcgtcgtcaccgaccggctgcacacccgcaccggcgacgcggccggcgaactgctcgcc
ttcctgcgcgccgagagcggcaacccggacctcggtcacgacgaggaggtcgccgcctcc
gaggccgcgcacggcgaccggaatgccgcgctggcgcacttcatggcgtcctacggcaac
atcgacaaccccgtcccggtgctcctggaccagtacttccgccagtgctccgtcgccgcg
tcctgcgccgacctggccctggccaccggcttcctggcccggcacggcatccgtgcggac
ggcacccggctgctcagccgcagccgggccaagcagatcaacgcggtgatgctgacctgc
gggacctacgacgcggccggcgacttcgcgcaccgggtgggtctgccgggcaagagcggg
gtcggcggcggcatcatcgcggtggtgccgggacactgcacgctgtgcgtgtggggcccc
ggcctggacgagcggggcaactcggtggccggggtggcggccctggaccgcttcacgacg
ctcacggggctgtcggtgttctga

DBGET integrated database retrieval system