KEGG   Streptomyces coelicolor: SCO7123Help
Entry
SCO7123           CDS       T00085                                 

Gene name
SC4B10.24c
Definition
acyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sco  Streptomyces coelicolor
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO7123 (SC4B10.24c)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCO7123 (SC4B10.24c)
  Amino acid metabolism
   00310 Lysine degradation
    SCO7123 (SC4B10.24c)
Enzymes [BR:sco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SCO7123 (SC4B10.24c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(7913374..7914627)
Genome map
AA seq 417 aa AA seqDB search
MTVSVTLPALGESVTEGTVTRWLKQVGDRVEADEPLLEVSTDKVDTEIPSPAAGVLLEIL
AAEDETVEVGAGLGIIGAPDTAPAAPAAPAAPAPAPAPTPTPTPTPTPTASAPAPTPAPA
PAPAPAPAPAEPFVPPAASAVPAPPAPAPAPTTPQAPAPAPAPVRAAPAEDASSLRGRTV
AMTRIRRAIGNNLKKALLEQAQLTSTVEADVTRLMRLRNRAKDGFLAREGLKLSPMPFFV
KAAAQALKAHPVVNARINEDEGTITYFDSENIGIAVDTEAGLMTPVVKAAGDLTVAGLAR
AVHDLADRARGGHLTPDDVSGATFTISNTGSRGALFDTVIVPPNQAAILGVGATVRRPGV
VRVGDEEVIGVRDLVHLSLSYDHRLVDGADAARYLTAVKALLESAAFEDDLYPDAAA
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtttccgtgaccctgccggctctcggcgagtccgtcaccgagggcaccgtgacc
cgctggctgaagcaggtcggtgaccgcgtcgaggccgacgagcccttgctggaggtgtcg
accgacaaggtggacaccgagattccctcccctgccgcgggcgtcctgctggagatcctc
gccgccgaggacgagaccgtcgaggtcggtgccggcctcggcatcatcggcgcaccggac
acggccccggcggccccagcggccccggccgcaccggcacccgcacccgcacccacaccc
acacccacacccacacccacacccacagcatcggcgccggctcccactccggctccggct
ccggctccggctccggctccggctccggccgagcctttcgtgccgcctgccgcgtccgcc
gttccggctccccccgcgccggcgccggcacccacgactccgcaggcaccggcgcccgcg
cccgcgccggtgcgcgccgccccggcggaggacgcctcctcgctccgcggccgcacggtc
gcgatgacccgtatccgccgggccatcggcaacaacctcaagaaggcgctgttggagcag
gcgcagctcacctcgacggtcgaggccgacgtcacccggctcatgcgcctgcggaaccgg
gccaaggacgggttcctggcccgggagggcctcaagctctcccccatgcccttcttcgtc
aaggcagccgcccaggcgctgaaggcgcatccggtggtcaacgctcggatcaacgaggac
gaggggaccatcacctacttcgacagcgagaacatcgggatcgcggtcgacacggaggcc
ggtctgatgaccccggtcgtcaaggcggccggtgacctcaccgtcgccgggctcgcccgg
gccgtccacgacctcgccgaccgggcccgcggtggtcacctgaccccggacgacgtgtcg
ggcgcgaccttcacgatctccaacaccggttcgcgcggcgccctgttcgacaccgtcatc
gtgccgccgaaccaggccgcgatcctcggcgtgggcgccacggtcaggaggccgggggtc
gtgcgcgtcggtgacgaggaggtcatcggcgtccgggacctggtgcacctgtcgctgtcg
tacgaccaccggctggtggacggcgcggacgcggcccgctacctgacggcggtcaaggcg
ctcctggagtcggcggcgttcgaggacgacctgtaccccgacgccgctgcgtga

DBGET integrated database retrieval system